SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000007144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000007144
Domain Number 1 Region: 176-353
Classification Level Classification E-value
Superfamily MIR domain 9.59e-51
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1040-1154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-18
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 3953-4031
Classification Level Classification E-value
Superfamily EF-hand 0.000000000748
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 618-766
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000241
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 60-141
Classification Level Classification E-value
Superfamily MIR domain 0.00000353
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 393-507
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000562
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000007144
Domain Number - Region: 1371-1492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000554
Family SPRY domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000007144
Sequence length 4898
Comment (Cavia porcellus)
Sequence
AQNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLL
YGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEK
VRVGDDLILVSVSSERYLHLSYGTGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVL
RLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQP
FRLRHVTTGKYLSLLEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVSVRKEVDGMGTSEI
KYGDSVCYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESR
TARVIRSTVFLFNRFIRGLDALSKKVKVPAVDLPIESVSLSLQDLIGYFHPPDEHLEHED
KQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGEAWKSILNSLY
ELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHI
KSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSS
MRPNIFLGISEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWG
GNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLKTDDVISCCLDLSAPSISFRINGQP
VQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKV
EHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTTQIVLPPHLERIREKLAENIHELWV
MNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGLSD
EHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPAQEAMVDRLAENAHNVWARDRIRQ
GWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAAR
AEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDERA
FAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKD
FDVGDGFIPACSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKR
LPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSSTDLMFYRLSMPIECAEVF
SKTMAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEASKPEFNNHK
DYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFP
GQEPANVWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESM
SPGQGRNNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQ
FELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISER
QGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAH
ALCSHVDEPQLLYAIENKYMPGLLRSGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETK
SITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKAKTMQM
LTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPRVFKEA
ACVEEEGDVLEKELSTEDSKLEGAGEEDVKVGKAPKEGLLQMKLPEPVKLQMCLLLQYLC
DCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQIN
MLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVE
KVTYLKKKQSEKPVASDAKKSSSLQQLISETMVRWAQESIIEDPELVRAMFVLLHRQYDG
IGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKV
FYQHPNLMRALGMHETVMEVMVNVLGGGESKNITFEKMHFSILNFKMYFSHYGIKSIIIH
INPILHNLSLESASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSC
QMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRG
EGGNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKTLDTEEEEDDTIHMGNAIMTFYAALID
LLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMS
AGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALN
RYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSIC
GQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEE
LHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDS
EGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLM
KPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDA
AHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTL
TAKEKAKDREKAQDILKFLQINGYAVSRRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEA
HQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHA
SNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSA
LRAFLDNAAEDLENTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQ
FGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLD
KHNVHSIYNTKSSRERAALNLPPNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVME
VVLPMLCSYMSRWWEHGPENNPERSEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWM
KRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVAEEDHLKAEARGDMSEAELLIL
DEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREE
QNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPI
GLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPN
RTEDTSDPERTVERVLDIANVLFHLEQKSKCIGRRYYNLVEHPQRSKKAVWHKLLSKQRK
RAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAKPPEEDE
AAKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEE
KEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQK
MLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFT
CDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKD
VIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQM
KLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKF
FDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENE
TLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRI
EIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDT
IFEMQLAAQISESDLNERSTNKEESEKERLEEQGPRMGFFSILTVRSALLALRYNILTLM
RMLSLKSLTMKDMVTAFFSSYWSVFVTLLHFVASVCRGFFRIVCSLLLGGSLVEGAKKIK
VAELLANMPDPTQDEVRGDGEEGERKPMETPLPSEDLTDLKELAEESDLLSDIFGLDLKR
EGGQYKLIPHNPNAGLGDLMSNPVPIPEVQEKFQERSGFLLNKEHKLTLKSEPEKAEGED
GEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLA
LFVAFAINFILLFYKVSTASVAEGKELPTRSPSESAKVTTSLDSSSHRIIAVHYVLEESS
GYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDD
IKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREK
KKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNTAHLLDIAMG
FKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDM
LTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDA
FGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKD
ETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences ENSCPOP00000007144 10141.ENSCPOP00000007144 ENSCPOP00000007144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]