SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000007408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000007408
Domain Number 1 Region: 100-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 12-78
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 434-484
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000707
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000007408
Sequence length 489
Comment (Cavia porcellus)
Sequence
RKKSVNMTECVPVPSSEHVAEIVGRQGGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKE
DVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVGLVVGP
KGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEAHIALRTGGIVELTDE
NDFHANGTDVGFDLHHGSGGSGPGSLWSKPTHSITPTPGRKPFSSYRNDSSSSLGSASTD
SYFGGGTGGSATATPRLADYSPPSPALSFAHNGNNNNNGNGYTYPAGDAPAPSPDGCPEL
QPTFDPAPAPPPGAPLLWAQFERPQEVLCSPGVVFLLHKVVIPRDGARGHPTPARGRAWR
QLIAPCLHVPQGLGGVRTPPGSPGAQRPQRRRSGTTPSSPTGLGTQSCLVCSPRTRRVSR
LPAPPPDLPPLMKGSRDCSVCFESEVIAALVPCGHNLFCMECANRICEKSEPECPVCHAA
VTQAIRIFS
Download sequence
Identical sequences ENSCPOP00000007408 10141.ENSCPOP00000007408 ENSCPOP00000007408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]