SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000007641 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000007641
Domain Number 1 Region: 983-1184
Classification Level Classification E-value
Superfamily vWA-like 2.08e-57
Family Integrin A (or I) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 118-309
Classification Level Classification E-value
Superfamily vWA-like 1.36e-56
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 1202-1406
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-33
Family Laminin G-like module 0.037
Further Details:      
 
Domain Number 4 Region: 420-587
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 3-95,317-403
Classification Level Classification E-value
Superfamily Fibronectin type III 3.71e-19
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 712-882
Classification Level Classification E-value
Superfamily Fibronectin type III 5.63e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 603-685
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000302
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 8 Region: 895-978
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000246
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000007641
Sequence length 1769
Comment (Cavia porcellus)
Sequence
SVSAPTRLRYHVLSQDSIQISWKAPRGKFGGYRLLVTPASGGKTNQLNLQNTATKAIIQG
LMPEQNYTVQIIAYHKDKESKPAQGQFRIKDLEKKKDPAKPRGKVVDRGNGSQPASPEEP
KFVCQTPAIADIVILVDGSWSIGRFNFRLVRLFLENLVTAFNVGSGETRVGLAQYSGDPR
IEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLALNYIFENSFKPEAGSRTGVAKIGILIT
DGKSQDDIVPPSRRLRESGVELFAIGVKNADLSELQEIASEPDSSHVYNVAEFDLMHTVV
DSLTRTVCSGVEEQDREIRASAFTTTGPPTELITSEVTARSFMVNWTHAPGNVQKYRVVY
YPTRGGKPEEVVVDRSVTSLVLKNLMSLTEYQISVFAIYAHTASEGLRGTETTLALPMAS
DLELYGVTENSLRVRWDPVPGATGYLVLYAPLTEGLAGDEKEMKIGETHTDIELTGLVPN
TEYTVTVYAMFGEEASDPVTGQEMTLPLSPPRNLRISNIGSSSARLSWDPTSTKTSGYRI
VYTSADGTEINEVEVDPITTFPLKGLTPLTQYSIAVFSIYDEGQSLPLVGTFTTEEVPAQ
QYLEIDEVKTDSFRVTWHPLSAEEGQHKLMWIPVYGGKTEEVVLKEEQDSYVIEGLDPGT
EYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEPATTVEPTRPVTSVSQTGIRNLVVDDET
PSSLRVSWDISDSDVEQFRVTYLTAQGDPAEEVVGTVMVPGNQNSVLLKALLSDTEYKVT
VTPIYSNGEGVSVSAPGKTSPSSGPQNLRVSEEWYNRVRISWDAPPGPVKGYRILYKPVS
VPGPTLETFVGADINTILITNLLSGMDYSVKIFASQAAGFSDALTGLVKTLFLGVTDLQA
HQVEMTSLCARWQVQRHASAYRIVVESIQDTQKQESIVGGGTNRHCFYGLQPDSEYKISV
YTKLQELEGPSVSITEKTRSHPTPPPTFPPTIPPAREVCRAAKADLVFMVDGSWSIGDDN
FNKIISFLYSTVGALDKIGPDGTQVAMVQFTDDPRTEFTLNAYKTKETLLDAIKHISYKG
GNTKTGKAMQHVRDSLFGAEAGTRRGVPKVIVVITDGRSQDEVSRICREMQADGYNIFAI
GVADADYSELVSIGSQPSARRVFFVDDFDAFKKIEDELITSVCEAASATVSLSFTLLFSL
EGFKMMEVFGLVEKDFSSVEGVSMAPGTFNVYPCYQLHRDALVSQPTKYVHPEGLPADYT
ITFLFRILPETPQEPFALWEILNKNSAPLVGIILDNGGKTLTYFNYDHAGDFQTVTFEGP
EIRKIFYGSFHKLHVVVSKNLVQVVVDCKPVGEKPINASANITSDGVEVLGRMVRAEAPG
GNSAPFQLQMFDILCSTAWASKDRCCELPGLRDEQSCPELPHSCTCAVTNEVALGPAGPP
GGPGLRGPKGQQGEQGPKGPEGPRGESGPAGPQGPPGPQGPSGLSIQGMPGMPGEKGEKG
DTGLPGPQGMPGGVGSPGRDGSPGQRGFPGKDGSSGPPGPPGPIGIPGAPGVPGVTGSVG
PQGALGPPGVPGAKGERGERGDLQSQAMVRAVARQVCEQLIQSHMARYTAILNQIPSHHS
SIRTIQGPPGEPGRPGSPGTPGEQGPPGAPGFPGNAGLPGTPGDRGLTGLKGEKGNPGIG
TQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGPPGHLGVPGPQGPSGQPGYCDPSSCSAY
GVGAPHPDQPEFTPVQDEQEALELWGSGI
Download sequence
Identical sequences ENSCPOP00000007641 ENSCPOP00000007641 10141.ENSCPOP00000007641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]