SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008211
Domain Number 1 Region: 19-204,306-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-62
Family Calnexin/calreticulin 0.00023
Further Details:      
 
Domain Number 2 Region: 232-310
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.00000000000000916
Family P-domain of calnexin/calreticulin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008211
Sequence length 371
Comment (Cavia porcellus)
Sequence
MAWARVSLWALCALRVALATVYFQEEFLDGERWRNRWVPSTNDSRLGHFRLSSGKFYGHK
EKDKGLQTTQDSRFYAISARFPPFSNKGRTLVLQYTVKHEQKMDCGGGYVKLFPADLDPR
TLNSQSPYYIMFGPDICGFDFKKVHVILQFKNEYHANKKTIKCKVDGFTHLYTLILRPDL
TYEVKIDGQSTELGSIEHDWHLTSLRKTAAMVVAAAADTDQGRARTAQTAFANGQDWKKH
FLDARANKPSDWNSELDRDWPGPMLQKPPYQDGLKPEGINPDIWLHEKMSSTSYLAQYDL
SEFENIGAIGLELWQVRSGTIFDNFLLTDDEAYAENFGKATWGQTKGPEKEMDDILIKEE
LIRAREEEEDE
Download sequence
Identical sequences ENSCPOP00000008211 10141.ENSCPOP00000008211 ENSCPOP00000008211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]