SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008384
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 6.02e-40
Family Rap30/74 interaction domains 0.000000568
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.17e-23
Family DNA-binding domain from rap30 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008384
Sequence length 249
Comment (Cavia porcellus)
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWTKAPGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGIQNVKGIHKNTWELKPEYR
HYQGEEKND
Download sequence
Identical sequences A0A286XX17
10141.ENSCPOP00000008384 ENSCPOP00000008384 ENSCPOP00000008384 XP_003477520.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]