SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008464 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008464
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-41
Family Calponin-homology domain, CH-domain 0.000000429
Further Details:      
 
Domain Number 2 Region: 187-243
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.18e-17
Family EB1 dimerisation domain-like 0.0000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008464
Sequence length 257
Comment (Cavia porcellus)
Sequence
MAVNIYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDILFPCSIVLKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPEFQDNFEFVQWFKKFFDANYNGKECDPV
AARQGQETAVAPSLVAPALNKLKKLLSSSSAAPQRPILTQRTTLTPKAGSGVVRKNLGVG
NGDDEAPELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENDPVLQRIVDILYATDE
GFMIPDEGGPQEEQEEY
Download sequence
Identical sequences ENSCPOP00000008464 ENSCPOP00000008464 10141.ENSCPOP00000008464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]