SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008572
Domain Number 1 Region: 473-638
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000087
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 17-164
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000293
Family Xylanase/endoglucanase 11/12 0.084
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000008572
Domain Number - Region: 678-837
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00768
Family SPRY domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008572
Sequence length 1515
Comment (Cavia porcellus)
Sequence
SSGGLGSVGELHPRTGRLVSLSACGRTARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDR
KVNSWSGSIEIGVTALDPSVLDFPSSATGLKGGSWVVSYGQDLDQLGEGDRVGVERTAAG
ELRLWVNGRDCGVAATGLPSRVWAVVDLYGKCTQITVLPTEPGFSPPTPIPSTPLEPSAP
PEESALTEQGTSGDEGSTAGAAQQSHPWTLPNSLETHNDFASMELSEVVSNTILSAYNGG
LLNVNLSSPPAGDGLGSSGTATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEF
NNGVVMTNRPLRDNEMFEIRIDKLVDKWSGSIEIGVTTHNPNNLEYPATMTNLQSGTIMM
SGCGILTNGKGTRREYCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVV
YGVVDLYGMAVKVTIVHNNNHSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPN
CGQKAAITHEGRTALRPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVT
THNPAYLQLPSTMTNLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDG
TLHFFVNGMTQGPAAWNVPPGVYAVVDLYGQAAQATIVDDVEVPPVPEPLPEGNNQVSPS
SPSSGAGGSDLRFHQLHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVI
QKMVDRWSGSIEAGVTAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLD
ALGTGARIGMMRTAKGDLHYFINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITNATG
PMDNSLATSNTATEKSFPLHSPVAGVAHRFHNTCGKNVTLEEDGTRAVRAVGYSHGLVFS
TKELKAEEVFEVKVEELDEKWAGSLRLGLTTLVPGEMGPGAGSGPGLPPSLPELRTKTTW
MVSSCEVRRDGQLQRMNYGRNLERLGVGSRVGIRRGADDTMHVLVDGEDMGPAATGIAKN
VWAVLDLYGPVRSVSIVSSTRLEEPEITQPPSPSSDTGSEGEEDDESEERGLGGQNQMGI
MPTVLEFLENHGKNILLSNGNRTATRVASYNQGIVVISQPLLPQLLVQVRIDFLNRQWTS
SLVLGVITCPPERLNFPASACALKRAAWLLRGRGIFHNGLKICEKFGPNLDTCPEGTILG
LRLDSSGGLHLHVNGVDQGVAVPDVPQPCHALVDLYGQCEQVTIVSPEPGAASGKSAGTQ
GDMEKADMVDGIKESVCWGPPPAASPLKSCEYHALCSRFQELLLLPEDYFMPPPKRSLCY
CESCRKLRGDEAHRRRGEPPREYALPFGWCRFNLRVNPRLEAGTLTKKWHMAYHGSSVAA
VRRVLDRGELGAGTASILSCRPLKGDPGVGFEEPGENCAPPREEQPPPVLLSPSLQYAGA
ETLASKVQFRDPKSQRTHQAQVAFQVCVRPGSYTHGPPSAALREPPDPHFSPAELEWVTK
EKGATLLYALLVRVE
Download sequence
Identical sequences ENSCPOP00000008572 ENSCPOP00000008572 10141.ENSCPOP00000008572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]