SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008610
Domain Number 1 Region: 3509-3674
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.67e-24
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 3324-3499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-22
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 3 Region: 3107-3288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.08e-19
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 4 Region: 2917-3106
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000111
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 5 Region: 2722-2905
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000285
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 6 Region: 1912-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000781
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 7 Region: 1960-2015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 8 Region: 670-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 9 Region: 1431-1479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 10 Region: 534-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 11 Region: 352-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 12 Region: 1570-1618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 13 Region: 1521-1572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 293-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 15 Region: 1854-1906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000301
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 16 Region: 769-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 17 Region: 717-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 18 Region: 2014-2058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 19 Region: 625-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 20 Region: 580-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 21 Region: 422-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 22 Region: 822-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 23 Region: 487-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000212
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 24 Region: 2061-2110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.0093
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000008610
Domain Number - Region: 1816-1856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000123
Family Laminin-type module 0.064
Further Details:      
 
Domain Number - Region: 98-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00489
Family APC10-like 0.036
Further Details:      
 
Domain Number - Region: 1483-1523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family Laminin-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008610
Sequence length 3687
Comment (Cavia porcellus)
Sequence
ILGRLCTGSCPGVSGWSHPQPPAPAPMLPPQVAMSGLSWPRSEAGGFSLHPPYFNLAEGR
IAASATCGEAEDLYCKLVGGPVAGGDPSQTIQGQYCDICTAANSNKAHPASNAIDGTERW
WQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSTDFGHTYQPWQF
FASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLVNGRPGAMNFSYS
PRLRDFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISVGGRCVCHGHAD
VCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANECQSCNCHGHAHD
CYYDPEVDRRNASQNQDNVYQGGGVCIDCQHHTTGINCERCLPGFYRSPDQPLDSPHACL
RCSCESAFTDGTCEDLTGRCYCRPNFTGERCDACAEGFVVFPQCSPLPSAHNDSREQVLP
AGQIVHCDCSAGGTQGNSCRKDPRVGRCVCKPNFQGAHCELCAPGFYGPSCQPCQCTSPG
VADGLCDPDSGQCRCRIGFEGAACDRCAPGYFRFPLCQLCGCSPVGTLPEGCDEAGRCPC
RPGFDGPYCDHCRPGHHGYPNCQACTCDPRGALEQFCGVGGSCLCRPGYAGAACQECSPG
FHGFPACTPCHCSTDGSLHSACDPRTGQCSCRPRVTGLRCDMCVPGAYNFPSCEAGSCHP
AGLAPANPTLPEAQGPCVCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDPRGTLGGV
SECQPGSGQCFCKPHVCGLSCAACKEGFFGLDQADYFGCHSCRCDVGGALGQGCDPRTGA
CRCRPNTQGPTCSEPVKDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFENFSWRGYA
HMAPIQPRIVARLNITSPDLFRLVFRYVNRGPTSVSGRVSMREDSKFATCTNCTEQSQPV
AFPPSTEPAFVTVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVVLLPSVYYEAALLQLRV
TEACTYRPSARRSGENCLLYAHLPLDGFPSAAGPEALCGHDNSLPRPCPTEQLSPSHPPL
AACLGSDVDVQLQVTVPRPGHYALVVEYANEDARQEVGVAVHTPQQPPQLGVITLHPCPY
STLCRGPVLDAQHHTATFSLDSEASVRLTAEQAHFFLHGVTLVPAEEFSAEFVEPRVRCV
SSHGTFGPGSASCLPSRFPKPPQPIILRDCQVLPLPPSLPLSHSQELTPGAAPAGPQPRP
PTAVDPDTEPTLLRHPQGTVVFTTQVPVLGRYAFLLHGYQPAHPTFPVEVLINGGRVWQG
HANASFCPHGYGCRTLVLCEGQAVLDVTDSELTVTVRVPEGRWLWLDYVLVIPEDAYSSS
YLQEEPLDKSYDFISHCAAHGYHISPGSSSPFCQDAATSLSLFYNNGALPCGCHEVGATG
PTCDPFGGQCPCRAHVIGRDCSRCATGYWGFPSCRPCDCGARLCDEITGQCICPPRTVPP
DCLVCQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDVDSGQCKCRPNVAGRRCDTCAPG
FHGYPSCHPCDCHEAGTAPGVCDPLTGRCYCKENVQGPRCDQCRLGTFSLDAANPKGCTR
CFCFGATENCRSSAHARREFVDMEGWTLLSADRQVMPHTHRAEAELLHADLRTLAEDSFP
ELYWQAPPCCRSCEVSSYGGTLRYQLHSETQRGDVFIPTESRPDVVLQGNQMSIAFLEPA
YPAPGHTHRGQLLLVEENFRHVETHNPVSREELMMVLAGLEQLQIRALFSQISSSVSLHR
VALEVASEMGSGPPASNVELCMCPANYRGDSCQECAPGYYRDVKGLFLGRCVPCQCHGHS
DHCLPGSGVCVGCQHNTEGDRCERCRAGFVRSRPEDPSAPCVSCPCPLAVPSNNFAEGCI
LRGGRTQCLCRPGYTGASCERCAPGFFGNPLVLGSSCQPCDCSGNSDPNMIFSDCDPLTG
ACHSCLRHTTGPRCESCAPGFFGNALLPGNCTPCDCSPCGTEACDPQSGRCLCKAGVTGH
RCDRCQEGHFGFEGCQGCRPCACGPAAEGSECHPQSGQCRCQPGAGGLQCHECAPGHWGL
PERGCRRCQCPGGHCDPHTGRCTCPPGLSGERCDTCSQQHQVPVPGSPSSPGVHCEVCDH
CVVLLLDDLERAGALFSAIREQLRGVNASSAAWAQLHRLNASITDLQDQLRSPRYQVEQQ
LQTLEHRSLNLEQDVQQLDSQATGAQDLAGRLLDSTEGMLGRAQTLLVTIQAVDRALSEL
ASQVGLVSPANVSTPSGEQLRRTLAEVDKFLQEMRARDFRAPRTVAEVELAEAQRLLARV
QEQLTSRWEENQVLAKHIRDGLAQHEAGLMDLREALNRAVGITREAEELNSRNQARLEEA
LQHKRELAQDNATLKATLEAAGRTLARVSELLQGMERAKEDLEHLAASLDGARTPLLEKI
RTFSPAGSKVDLVETAEAHAEQLNQLALNLSSIILGINQDRFIQRAVEASNAYSSILKAM
QAAEDSAGQAWQQASHTWETVVEQGLAARAQQLLANSSALEEAVLGQQQRLGLMRVTLQD
TRTQLEDIQAAKDQLVARIQEVQAMLAMHTDETSKKLARAKAMAAEAQDTAARVQAQLQD
MQRNLEQWQGQFGGLRGQDLGQVVLDAGHSVSSLEKTLPQLLAKLSLLENRGTHNASLAL
SASIGRVRELIAQARGAASKVRVSMKFNGRSGVQLRTPRDLADLAAYTALRFHLQSPELA
PESGQEAGDRFVLYMGSRQATGDYMGVALRKQKVHWVYRLGDAGPVTLSIDEDIGEQFAT
ISIDRTLQFGHMSVTVEEPIVQETKGDAVAPGVEGLLSLQPDDFIFYVGGYPSSFTPPAP
LRFPGYVGCIELDTLNEEVVSLYNFERTFRVDTAVDRPCARSKSTGDPWLTDGSYLDGTG
FAHVSFERQMSTTKRFDQELRLVSYSGIIFFLQHQGQFLCLAVRKGSLVLLYDLGAGLKE
AVPMQPPPPLTTASKAIQVFLLAGSRKRMLVRVERTTVFSVEQDNTLDLATAYYLGGVPP
DQLPPSLQQLFPSGGSIRGCIKGIKALGKYVDLKRLNTTGVSSGCTADLLVGRTMTFYGH
GFLPLALPEVPPLTGDVYSGIGFRSTQDNGLLYHRASLDGLCQVSLQQGHVTLRLMRTEL
RTPGVFSDGAPHYAAFYSNASGVWLYVDDQLQQMRPHRGAPPRQHPSPPEEPPQLLLGGL
SEAAASFRNFSGCISNVFVQRLQGPQRVFDLQQNLGSTNVSTGCALVPLPRASGQRARGL
RAVARKASRRSRQPRQDPACMSPLHLRMTQDTFQFGGPLPSFLEFEGLLDPRRNRFRLSM
LVRPRAPQGLLLLVAPLAASSPSLTLFLSHGQFVARTEGPGPRLRVQSRQRSRAGRWHTV
SLRWEEGQLHLLTDGVPAWSHHHPGPSRIEVPLQPHTLFVGGLPRSPSSRLPVAAGLSGC
VKRLQLDGRPVGAPTRVVGVTPCFSGPLESGLFFPGTGGVITAEPPVATLHHVRLELEVR
PSTAAGLVLRLGPARGPPYLQLQVSRKQVLLQADDGEGEFSTWVTHPVALCDAQWHRLAA
TKDENVLRLEVDAQSNHTEGPLAAAMADGPAPLHLGGLPEPNLSTPESGLPAYGGCMRKL
LVNGSPLALTSLAGVQGAAGASGCPAT
Download sequence
Identical sequences ENSCPOP00000008610 ENSCPOP00000008610 10141.ENSCPOP00000008610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]