SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008668
Domain Number 1 Region: 63-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.95e-42
Family beta-glycanases 0.046
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000008668
Domain Number - Region: 546-662
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0014
Family Clostridium neurotoxins, the second last domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008668
Sequence length 679
Comment (Cavia porcellus)
Sequence
MVGSSPEASRQRRVEAMTAAAGSAGRTVVSLLLCALLASGGAYVLDDSDGLGREFDGRCA
GNFGAAATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHY
ALDENYFRGYEWWLMKEAKKRNPDIILIGLPWSFPGWLGKGYSWPYVNIQLTAYYVVSWI
LGAKHYHDLDIDYIGIWNERTFDTSYIKVLRRMLDSQGLQQVNIIASDNLWEPISSFILR
DPELFRVIDVIGAHYPGTHVSQHAKLTKKKLWSSEDFSTLNNDVGAGCWGRILNQNYVNG
NMTSTIAWNLVASYYQELPYGRCGLMTAQEPWSGHYVIESPIWVSVAHTTQFTQPGWYYL
KTVGHLKQGGSYVALTDGLGNLTIIVETMSRRHSKCIRPYLPFYNVSAQSATFVLKGSFS
EIPELRMWYTKFGKPSERVLFKQRDSLWLLGGNGTFTLELKEDELGRKGSHPPPPKSQRF
PSVYKDNFNVDFPFFSEAPNFADQTGVFEYYINPEDPGEHRFTLRQVLNQRPITWAADAS
STISIIGDYHWTNLTISCDVYIETPKKGGVFIAGRVNKGGLLVRISQGVFFWIFANGMYR
VTGDLAGWLIYSSGYVEVTAKKWYTLTLTIKGNLSSGKLNGKVLWENIHVKYPKNGWAAI
GTHSFEFAQFDNFHVEVTN
Download sequence
Identical sequences ENSCPOP00000008668 10141.ENSCPOP00000008668 ENSCPOP00000008668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]