SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008811
Domain Number 1 Region: 185-351,392-526
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.15e-58
Family Tandem AAA-ATPase domain 0.00049
Further Details:      
 
Domain Number 2 Region: 11-149
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-31
Family SPRY domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008811
Sequence length 639
Comment (Cavia porcellus)
Sequence
AIGPDGVCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDK
FGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIEKGHVKFSKNVGKDLGLAFEIPAH
MKNQALFPACVLKNAELKFNFGEEDFKFPPKDGFVALCKAPESYIVKSQHTGNAQVTQTK
FLPNAPKALIVEPSRELAEQTLNNVKQFKKYVDNPKLRELLIIGGVAARDQLSVLENGVD
IVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFISRMHSQIPQITSDGKRL
QVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGK
NHIRTDDVHAKDNTRPGANSAEMWSEAVKVLKGEYTVRAIKEHKMDQAIIFCRTKIDCDN
LEQYFMQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDI
HGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNT
RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRALGGGSY
KGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
Download sequence
Identical sequences ENSCPOP00000008811 10141.ENSCPOP00000008811 ENSCPOP00000008811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]