SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008989 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008989
Domain Number 1 Region: 306-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.54e-23
Family Clostridium neurotoxins, the second last domain 0.026
Further Details:      
 
Domain Number 2 Region: 114-220
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000671
Family Cadherin 0.0052
Further Details:      
 
Domain Number 3 Region: 5-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000171
Family Cadherin 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008989
Sequence length 899
Comment (Cavia porcellus)
Sequence
NLVNKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAGEICGFKIHGQNVPFDA
VVVDKSTGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGAGVKKSHKATVHIQVNDVN
EYAPVFKEKSYKATATEGKQHDSILRVEAVDADCSPQFSQICSYEIVTPNVPFAVDKDGY
IRNTEKLSYGKEQQYKLSVTAYDCGKKRAAEDVLVKISIKPTCTPGWQGWSNRVEYEPGT
GALAVFPNIHLETCDEPVALVQATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELL
PSPSSSLNWTIGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSINPKEPFTISVWMRHGPFG
RKKETILCSSDKTDMNRHHYSLYVHGCRLIFLLRQDPSEEKRYRPAEFHWKLNQVCDAEW
HHFVLNVELPSATLYVDGVPHEPFSVTEDYPLHPSKIDTQLVVGACWQEYSGVESDNDTE
PVTVASAGGDLHMAQFFRGNLAGLTVRSGKLTDKKVIDCLYTCKEGLGLQGPEDSGGVQI
RAGPSQSVLTLEGDDIGELDRAMQHLSYLNSRQFPTPGIRRLRVTSTAKCFNEAATCIEI
PVVEGYVMVLQPEEPKISLSGIHHFARAASEFESPEGVFLFPELRIISTITREVEPEGDG
AEDPTVQESLVSEEVVHDLDTCEVTVEGEELNPEQESLEVDAVRLQQKGIEVSHSDLGVV
LRGVDTMASYEEVLHLLRYRNWHASSLLDRKFKLICSELNGRYLSNEFKVEVNVIHTASP
VEHASHMAAQPQFVHPEHRSFVDLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILG
VFRIRAAHQRTMRDQDSGKENEMDWDDSALTITVNPMETYEDQHSNITSAESESSEEEE
Download sequence
Identical sequences 10141.ENSCPOP00000008989 ENSCPOP00000008989 ENSCPOP00000008989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]