SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009264
Domain Number 1 Region: 159-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000258
Further Details:      
 
Domain Number 2 Region: 67-147
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000367
Further Details:      
 
Domain Number 3 Region: 352-427
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000732
Further Details:      
 
Domain Number 4 Region: 251-325
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009264
Sequence length 574
Comment (Cavia porcellus)
Sequence
MAELVQGQSAPVGMKAEGFVDALHRARQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPL
DDGVGNQLGALVHQRAVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGI
PERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHSDAEGNSTVQEILIPASKVGLVIGK
GGETIKQLQERAGVKMVMIQDGPLPTGTDKPLRITGDPFKVQQAREMVLEIVREKEQADF
RGVRGDFSSRLAGGSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGVSPERA
AQVMGPPDRCQHAAHIINELILTAQERDGFGSLAVARGRGRGRGDWNVGAPGGVQEITYT
VPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPSTDPGLRLFTIRGVPQQIEVARHL
IDEKVGGPSLGATGAFGQSPFSQPPATPHQNTFPPRGSGCFPSLAAKVNGNPHSTPVSGP
PAFLTQGWGSTYQAWQQPTQQVPSPQSQPQSSQPDYGKAWEDYYKKQSHPGHAPSATPQA
SSPPDYTMAWAEYYRQQVAFYGQTLGQAQHSQEQ
Download sequence
Identical sequences H0VGL9
ENSCPOP00000009264 10141.ENSCPOP00000009264 XP_003470987.2.53824 ENSCPOP00000009264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]