SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009390 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009390
Domain Number 1 Region: 623-778
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-38
Family SPRY domain 0.0058
Further Details:      
 
Domain Number 2 Region: 439-532
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000707
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000009390
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0544
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009390
Sequence length 787
Comment (Cavia porcellus)
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQMKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPAEGYILELD
DGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEGQKGKK
KPRKNTDSEEQTLPFPVPSERLPLRRMSPFSSTLNLQPSFPGRSYFDFRSSPHQMSLHSS
LQCLNAPGCNFETQSAPYSQLVDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDD
RVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAITEGGISK
GATIGVLLDLNRKTLTFFINDEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLPVPDFY
SSRASIA
Download sequence
Identical sequences ENSCPOP00000009390 10141.ENSCPOP00000009390 ENSCPOP00000009390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]