SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009439 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009439
Domain Number 1 Region: 233-434
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-46
Family DBL homology domain (DH-domain) 0.00000018
Further Details:      
 
Domain Number 2 Region: 427-551
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-28
Family Pleckstrin-homology domain (PH domain) 0.00000441
Further Details:      
 
Domain Number 3 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-27
Family Calponin-homology domain, CH-domain 0.00083
Further Details:      
 
Domain Number 4 Region: 162-232
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-24
Family SH3-domain 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009439
Sequence length 780
Comment (Cavia porcellus)
Sequence
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGLVDKYCLEP
QTEANCLSNINEFLKGCAALQVEVFDPDDLYSGVNFSKVLTTLLAVNKATEDQLSERPCG
RSSSLSAANSSQTSPQGAVSSTAPGPQKQAKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRIEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTKN
YYTVVLQNILDTEKEYAKELQSLLLTYLKPLQSNNNLSTVEFTSLLGNFEEICTFQQTLC
QALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDLMMIWKKFME
NQGASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQ
CQDLRKRKQLELQILSEPIQAWEGDDIKTLGNVIFMSQVMVQHGTCEEKEERYLMLFSNV
LIILSASPRMSGFIYQGKIPIAGMVVTRLDEIEGNDCTFEITVSIFSSIRATCESKGITK
WVDKLNKIIKSPRSLKGLSHITSSNCKHTFSQSFSSSGQPRGPLEPPQIIKPWSLSCLRP
APPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEED
AQILKVIEAYCTSANFQQEEGKSARKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVD
TVYALKDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTNECILAESSSKASILP
Download sequence
Identical sequences ENSCPOP00000009439 10141.ENSCPOP00000009439 ENSCPOP00000009439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]