SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009509
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-83
Family Calponin-homology domain, CH-domain 0.00000134
Further Details:      
 
Domain Number 2 Region: 1443-1667
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-52
Family Plakin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 1671-1849
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-48
Family Plakin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 2292-2501
Classification Level Classification E-value
Superfamily Plakin repeat 3.72e-44
Family Plakin repeat 0.00013
Further Details:      
 
Domain Number 5 Region: 6064-6222
Classification Level Classification E-value
Superfamily Spectrin repeat 6.58e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 5185-5345
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-29
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 6502-6652
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-27
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 2585-2692
Classification Level Classification E-value
Superfamily Plakin repeat 1.96e-25
Family Plakin repeat 0.00088
Further Details:      
 
Domain Number 9 Region: 242-358
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-24
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 10 Region: 5296-5438
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-23
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 11 Region: 6656-6772
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 12 Region: 4750-4907
Classification Level Classification E-value
Superfamily Spectrin repeat 2.78e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 13 Region: 6305-6443
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 5633-5777
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-21
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 15 Region: 6721-6848,6875-6906
Classification Level Classification E-value
Superfamily Spectrin repeat 8.47e-21
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 16 Region: 7025-7107
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.63e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 17 Region: 5861-6002
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 18 Region: 5405-5557
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-17
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 4462-4581
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-16
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 20 Region: 1159-1285,1312-1338
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 21 Region: 6936-7016
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000127
Family Polcalcin 0.057
Further Details:      
 
Domain Number 22 Region: 4660-4761
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000555
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 23 Region: 4964-5124
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000636
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 24 Region: 6226-6336
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000759
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 25 Region: 3735-3847
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000596
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 26 Region: 586-714
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000993
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 27 Region: 4350-4470
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000995
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 28 Region: 4189-4290
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000384
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 3856-3971
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000051
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 30 Region: 5778-5888
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000734
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 31 Region: 3973-4105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000104
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 32 Region: 523-613
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000128
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 33 Region: 2213-2293
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000759
Family Plakin repeat 0.0021
Further Details:      
 
Domain Number 34 Region: 4064-4182
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000173
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 35 Region: 675-796
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000259
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 36 Region: 3503-3621
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000523
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 37 Region: 4577-4692
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000119
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 38 Region: 3335-3489
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000432
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 39 Region: 1356-1472
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000317
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000009509
Domain Number - Region: 4901-4982
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0164
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 1040-1149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.018
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 5099-5177
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0518
Family Spectrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009509
Sequence length 7300
Comment (Cavia porcellus)
Sequence
VSFADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKG
RMRFHRLQNVQIALDFLKQRQQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYIS
GESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQI
QSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGIS
ATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKSFPQNPVELKALYNQYIHFKETEILAKE
KEKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERLEL
LLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQ
VDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELAPPSTLTTTHL
KAEPLTKATHSSSTSWFRKPMTRAELVSISSSEDEGNLRFVYELLSWVEEMQMKLERAEW
GSDLPSVELQLEAQQHIHASVEELGSSVKEARLYEGKMSQNFHTSYVETLGKLETQYCKL
KETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNISAKRNYFSELTVE
LEKKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMRQLCLCVEQHVKENTAY
FQFFSDARDLESFLKNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASL
VGRSKAIIQLKPRSPDHMLKSTISVKAICDYRQIEITICKNDECVLEDNSQRTKWKVISP
TGNEAMVPSVCFLIPAPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISWNYLRKDLD
LVQTWNLEKLRSSAPGEYHQVMKNLQTHYEDFLQDSHDSALFSVADRLRIEEEVETCKAH
FQHLMKSMENEDKEETVAKIYISELKNIRLRLEECEQRLVKRIQSPASSRTDKDARQDTA
LRIAEQEHTQEDLQQLKSELDAVSTKCNSFLHQSPSGSSVPTLRSELNLLVEKMDHICGL
SAVYLNKLKTIDIIVRNIQDAELLVKGYEIKLSQEETVPADLSALESHRSTLRHWLSDVK
NKNSVFSVLDEEIAKAKVVAEQLSRLTPERSLDLERYQEKGSQLQERWHRVIAQLETRQS
ELESIQEVLGEYRACHGTLIKWIENTTAQQETMKPGQAEDSRVLSEQLSQQTDLFAEIES
NQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDL
RTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNTQGK
ITSFHTKESTDIEKAIWEQQVLAEELATKKEQISEAIKTSQIFLAKHAHKLSEKEKEQIS
EQLSVLNKTYHELCDGSANQLQQLQSQLAQQTEQKGCKAVAGVIDLGTVEIFPIFRAMQK
GLIDQDTGLVLLESQVVMSGLIAPETSEMLSLEDGLARNLINPQMYQQLLELQDALFLIS
RHTESRGPLSVLEAIEKRIINERIGLKVLETYLATGGFSLSPSENCVNLEETFHQGLIST
WLHSLVESHLRSSKNLIDPNTAEKVSLLDLMQRCIIHKESGLRLLPVKQLAGGMVSLKSG
RKVSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVQEAVRHNLIDQDMACAI
LIRQLQTGGIIDTVTGHRMTIDEAVSNDLIAAKIALVILESLWSFMGLLHPDSGEILPII
DALEQGIVSTELAHDILSNRQHIKALFLPATTEVWSWKNAVENGILDEDLANNLKSICIP
DVMPNMQLADSADQSNLRITSQPAALPCSKGQTEDIASHDEKLLFQLMTHSYVNVQNGQR
VLLLDQELMETLTSRDEYHASPPEVFGIGHQRPYTHEELRESVNRNIAETFSDSLMSRPC
ERQFSSQNKEHPNQEDCSEAKNEKINTRVEYSSIENPEKHQLVEQNVSNANLKVIDKVKL
ELQRQLSGAKKEAQTEMSTKENDTKGLLLGVPPEEGLLVGKDLFSIETPEEELQTPRKTS
LTNQKEKRKTFMVEHTPCATERLLLNSQSKKSQLQIEKSVSLKSEVLSENDMNIPSLNEE
KMLSKMLLARDDHKQSQKGQNIADGNMMSEKIKTEGNGGETSMLCSHPSEVLEDSTLNIL
CAQLLNGGIIHEETGQKLLLNEAVAGGIVPSHTAVKLMGKLSMFRGFFDPQTCESLTTEE
VIDEGLMDEKLLHKVLMTDKAISGVLDPRTHTLCSINDAVRIGLLDKETASQILEGQVVT
GGIIDLKRGKRVSVTLASNLGLVDITDQTELINLEKAFKGKDTEKPIRERLIRLQMETTG
FMDPDSKVPLTIVESIDRGLLEKEEAVHLLTKQVVNGGIVHHTSGMRLTVDNAYKHGLIG
EDLAKQLKKVENVNLHQFFHPETKEALSLPEAIKLNLVAPDVKKEIQEIQTFNENFVDLI
SGQRLTVAEANKKGLLTNKAISSSGMMHGVIDPENYKIVPYSELVKKCKIDIESGQRYLE
VIPFSDIRDGVSDKVLSLSEAIQLGKVDFVSALKVLEAQANTGGIIDTATGKKLTLASAL
EQKLLDENMARIIASHQVLSGGIVDIFNDERVTLKEAVQKGLISPELATVIHTDTVKEQD
DIEVCESEDEFLRKEKLIVYSQIAKMSCDKGESEKLFAQEKFEGKVSNGKQTRKKREISE
FKGKDCEKGRASPDTIGSVSDIIPSSINMKSASPVSVPHSHSEVANFKLSGAGNMGKNTN
VEQEKVMPQIETLTHMKKSSLDLDAEDATENQEVISEVQEFNRKPPGKFLNEQPVNTREK
SKREKETTVEKSVNSCKSAAISEKKLTQKTADRDEHKSNKKKQSMEMVKGEKEKEADRDK
ELSVICKTEDFSSQMTPKGISVKNQDALTFFTSTPMSEEERKNVSLCLTFKTGENLSKKI
DVGAQSEPFSSVTPTSEESDFQQLVGKPQITDTSQMSKTDNIVQRATRQETNFYQGSCVT
LETKETKDLIFPLQEKSDQELPFDSKSALKLGKFTVSRIDPNEVSYLESSDRKDLHYQDS
KDDLELSEILKSKIAVTQETNGEKFQEVNPVVTGPETGSLEGIVTQKVPRDLVSLVPEKL
FKDVSEKVSAVQQGVIVALSALETSEEMALPLTKDGKTPQKELSEQSPSMAGPEGKGSRS
GDGNPQPLRATQNVFNRQLCLEHDEKLVSYLSLLRDIEMRTKQIQPLELNLAELQDLVCQ
AKVIDRELQALSTLVSQELECVNQIIVSQPQEVPTQLLKALEKDAKNLQKSLSSVSNTWS
TRLLHLQNAVEVKKTTVLNQHTQLESELQDLRAWVGDTSVILNNKECNSEADVISLSHSL
QQYKDLKQPMAERKSQLDALAFDIQFFISEHAQDLSPQQNRQMLRLLNELQKSFQDLVDW
TAAQTDALQGRLQQVQKEAQVKTLQQQQNTCHQKLEDLCSWVGQAERALESHQGRASHQE
LSALQKNQSDLKDLQEDIQNHTTAFTTVVKDIEVFLEENQTKLSPQELTALQEKLHQAKE
QYEALQEQTRVAQKELEEAVSSALQQETEKSKAAKELAENESKIDALLNWVTSVGSSSGH
QQTTLPGMKQLSGASPMQGTLDTTDGHMGVNHAPENLDRQCEKMKAHHQELLSQQQNFIL
ATQSAQAFLEQHGHNLTPEEQQNLQEKLGDLKEQYAASLARSEAELKQVQTLRDELQKFL
QDHREFESWLERSEKELENMRMGTIGPEALPSLLKQQGGFSEDVISHKGDLRFVTISGQK
VLDAENSSEESKEPSTTSDLVKERLKDATERYTALHSKCTQLGCHLNMLLGQHQQFQSSA
DSLQSWMQACDANVKKLLSDTVASDPGVLQQQLAMTKDKQKLQEELAEHQVPVEKLQKAA
HDFMEIEGEPAVDPKHVQETTDFILSHFQSLSCSLAERSALLQKAIAQSQSVQESLESLL
QSIREVEQNLEVEQVTSLSSGVIQEALANNMKWKQDIARQRSSLEATREMVTQFMETADS
TTAAVLQGKLAEVSQRFEQLLLQQQEKESTLKKLLPQAEMFEQLSDKLQQFMESKSRMLA
SGNQPDQDIAHFSQHIQELTLEMEDQQENLDTLEHLVTALGSCGFSLNLSQHQNKIQNLK
KDFTKLQKTVQEREKDASSCQEQLDEFRKLIRTFQKWLRETEGNIPPLETFISAKELEKQ
IEHLKDLLDDWTSKGTLVEEINHKGTSLENLITEITAPDSPAKTGSILPSVGSSVGSVNG
YHTCKDLTEIQCDMSDVNVKYEKLGGVLRDRQDSLQAILSRMEEVQKEASAVLQWLESKE
EVLKAMDATLSPTKTETVTAQAESNKAFLAELEQNSPKIQKVKEALAGLLMTYPNSQEAE
NWKKMQEELNSRWERATEVTVARQKQLEESASHLAGFQSAESQLRPWLMEKELMMGVLGP
LSIDPNMLNAQKQQVQFMLREFEARKQQHEQLNEAAQGILTGPGDVSPSTSQIQKELQSI
NQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVKAVGQRLSGQSAISTQPEAVK
QQLEETSEIRSDLEQLDNEIKEAQTLCNELSVLIGEQYLKDELKKRLETVTLPLQGLEDL
AADRMNRLQAALASTQQFQQMFDELRTWLDDKQSQQAKNCPISAKLERIQSQLQENEEFQ
KSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQMVELKSHWEELSKKTADRQSRLKD
CMQKAQKYQWHVEDLVPWIEDCKAKLSELQVTLDPVQLESGLLRAKAMLSEVEKRRSLLE
ILNGAADILINSSETDEDGIRDEKAGINQNMDAITLELQAKTGLLEEMSQRLKEFQESFK
NIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQALEPQVDYLRNFTQGLVEDA
PDGSDASQLLLQAEVIQQEFLEVKQRVTSGCMTMENKLEGIGQFHCRVREMFSQLADLDD
ELDGMGAIGRDTDSLQSQIEDVWLFLNKIQAVKFDIEASEAECQQMLEEEGTLDLLGLKR
ELEALNKQCSKLTERGKARQEQLELTLGRVEDFYRKLKALNEATTAAEEGEALQWVVGTE
VDLISQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGKNCDVQGLEHDMEEINARW
NTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLTDTEELIANQKPPSAEYKVVKAQIQ
EQKLLQRLLDDRKATVDMLQAEGDRIAQSAELADREKITGQLASLESRWTELLSKAAARQ
KQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTAKIQQQIVRHKALNEEIVN
RKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYVDITVTSSKALRTLEQARQLAT
KFQSTYEELTGWLREVEQELAASGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNEV
SRALLELVPWRAREGLDKLVSDANEQYKLISDTVGQRVDEIDAAIQRSQQYEQAADAELA
WVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFATCGEE
QKAVLQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEETRTLIAQ
LPPPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGKMVEEKYQKA
ENMYAQIKEEVRQRALALDEATSQSAQFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIR
ECINDNKSATMELEKLQPSFEALKRCGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDI
KARAEEREIKFLDVLELAEKFWYDMAALLTTIRDTQDIVHDLESPGIDPSIIKQQVEAAE
TIKEETDGLHEELEFIRILGADLIFACGETEKPEVKKSIDEMNNAWENLNKTWKERLEKL
EDAMQAAVHYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKGLEFKVEVYQQ
QIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAYRQHKLEGALLALG
QFQHALEELMGWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKA
GNELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQKAQGFHSEIEDFL
LELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDD
SGSGSKTEQSVALLEQKWRVVSSKLEERKLKLEEALSLATEFQNSLQEFINWLTLAEQSL
NIAPSPSLILNTVLSQIEEHKVFANEVNAHRDHIIELDQTGNQLKFLSQKQDVVLIKNLL
VSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPD
KIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLADDTQKLDNLLGEVRDKWDTV
CGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHK
VFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLE
QALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKKVEEKRVD
VNAAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAE
LLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYK
RKNVEPAHAPFIEKSRGGSRKPLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALE
RQRKLNDALDRLEELCLSKQLYPELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDK
DQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRP
TTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMV
RVGGGWMALDEFLVKNDPCRARGRTNLELREKFILPEGASQGMTPFRSRGRRSKPSSRAA
SPTRSSSSASQSNHSCTSMPSSPATPASGTKKIIPSTGSKLKRPTPTFHSSRTSLAGDTS
NSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTS
ESSAAGGQGSSRRGLTKPSKIPTMSKKTTTASPRTPAPKR
Download sequence
Identical sequences ENSCPOP00000009509 10141.ENSCPOP00000009509 ENSCPOP00000009509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]