SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009574 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009574
Domain Number 1 Region: 424-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-24
Family SPRY domain 0.012
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily RING/U-box 1.86e-16
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 186-236
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000293
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000009574
Domain Number - Region: 128-163
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0314
Family AN1-like Zinc finger 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009574
Sequence length 642
Comment (Cavia porcellus)
Sequence
MDGSGPFGCPICLEPLREPVTLPCGHNFCLACLGALWPHRSAGGAGGSGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRHGSGPGPMPTPAPTPARCPTPEPSAPSAPPSATEPSAPSA
PPSWAPAEESVHCDACPEGAVLPAALSCLTCLASFCPAHLGPHERSSRAARERPGAPRCA
GWRRACAASLRPLEATCRPERLCLCEACAAQEHRGHELVSLEQERALQEAEQPKVLSAVE
DRMDELAAGIAQSRRTVALIKSAAVAERERVSQLFAEAVATLQSFQKEVLGFIEEGEVLM
LGRSQGDLRRQEEQRGRLSRARQSLSQVPEADSVSFLQEFLALRLALEEGCGPGPSPPRE
LSFTKSSQAVRAVRDVLASACASQWEQLREQGGDQDGLQKLGSEADAESQDPDSTNLLQS
DAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGA
MDRGTYYWEVEIIEGWVSMGVMAEGFSPQEPYDRGRLGRNAHSCCLQWNGRNFSVWFHGL
EAALPHNFSPTVGICLEYADRALAFYTVHDGKMSLLRRLKASRPRRSGALASPTDPFQSR
LDSHFAGLFTHRLKPAFFLESVDAHVQIGPLKKSCITVLKRR
Download sequence
Identical sequences A0A286XHT4
ENSCPOP00000009574 ENSCPOP00000009574 10141.ENSCPOP00000009574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]