SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009958
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily L domain-like 2.38e-37
Family Ngr ectodomain-like 0.055
Further Details:      
 
Domain Number 2 Region: 477-591
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-28
Family Calponin-homology domain, CH-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009958
Sequence length 595
Comment (Cavia porcellus)
Sequence
DLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIINLQMLTYLNLSRNQLSSLPACL
CGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRNY
LKVLPPELVDLPLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVH
IFKYLSIQACQIKTSDSLYLHAMERPHLHQQVEDSKKDSDSGVGSDNGDKRLSATEPSDE
DAVSLNVPMSNIMEEEQTVQEDVCRRLTPAAGEFHQEFQPEPSLLGDSNNSEQERDQLAD
GADVLHSGFMSYIKDREEDCEELLRIEEDAHWQNEGIISSSKDQDVDIAMIEQLREAVDL
LQDPNGLSTDITERSILNLYPMGTAEDLELPDSALNGQIELETPAVCEVQNDLTLQSNGS
QYSPDEMRENSPTMFPTINSTAPFGLKPRSVFQRPQRNLESIDPQFTIRRKMEQLREEKE
LVEQLRESIEMRLKVTLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAK
CRRNVENFLEACRKLGVPEEKLCLPHHILEEKGLVKVGITVQALLDVTVTKTLFT
Download sequence
Identical sequences 10141.ENSCPOP00000009958 ENSCPOP00000009958 ENSCPOP00000009958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]