SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000010310
Domain Number 1 Region: 3155-3405
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-83
Family BEACH domain 0.000000902
Further Details:      
 
Domain Number 2 Region: 3522-3770
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.95e-34
Family WD40-repeat 0.0083
Further Details:      
 
Domain Number 3 Region: 2995-3093
Classification Level Classification E-value
Superfamily PH domain-like 4.49e-19
Family PreBEACH PH-like domain 0.013
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000010310
Domain Number - Region: 353-647,769-831,2279-2365
Classification Level Classification E-value
Superfamily ARM repeat 0.00547
Family HEAT repeat 0.049
Further Details:      
 
Domain Number - Region: 1458-1518,1569-1656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0116
Family Pentraxin (pentaxin) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010310
Sequence length 3784
Comment (Cavia porcellus)
Sequence
MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGRGFLLLTRLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEQQATDFNLPLSSNIILTKEKNSSSQRPTQE
KLYVEGSAPSGQDSAKINVFRKGRRQRKSTHRYSIRDARKTQLSTSDSEGNSDEKITIVN
KPRRPHVLQHFVTQSSKEALLTAKFDPSATKEQAPPDVMALENSREIIPRQESNADILSE
PAALSILSNMNNSPFDLCHVLLSLLEKVCKFDIMLNHNSALAASVVPTLTEFLAGFGDCC
NLSDSLESQVVSAGWTEEPMALVQRMLFRTVLHLMSVDISTTEVMPESLRKNLTELLRAA
LKIRSCLEKQPDPFAPRQKKTLQEVQEGFVFSQHRHQVLLLPELLEGVLQILICCLQSAA
SNPFYFSQAMDLVQEFIQHQGFNLFETAVLQMEWLVSRDGVPPDTSEHLKALINSVMKIM
STVKKVKSEQLHHSVCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSKNPFEETADGD
VHYPERCCCIAVCAHQCLRLLQQASLSSTCAQILAGVHSVGICCCMDPKSVIIPLLHAFK
LPALKNFQQHILNILSKLLLDQLGGAEISHKIEKAVCNICTIDSDQLAKLEETLQGNSCN
AESHSGLSSPSDRCQGILPRSGFEDLLWKWDALEAYQNFVFEEDRLYNIQIANHICSLIQ
KGNVIFQWKLYNYVFNPVLQRGVELAHHCQHLRITSARTHMCSHLKQCLPQEVLQIYLKT
LPVLLKSRVIRNLFLSCNGVNQIIELNYLDGIRSHSLKAFETLIINLGEPQKDASIPGFD
GLGIEQKEPSFSNVGTSFHNQQAYSDSPQSLSKFYASLKESYPKKWKTGHQDVQLNTINL
FLCVAFLCVSKEAESDRESASESEDTSGYDSTTSEPLSHVLPCLSLESLVLPSPEHMHHA
ADVWSMCRWIYMLSSVFQKQFHRLGGFRVCHKLVIMIIQKLLRDHKDEQERKQGDTNASE
NQILTRTCRPEITMKEDLSSLTIQSDYTLSELGSLKRTDDNLGKLDSQHISSIIVEQSST
SEAVPEEAKLLINQESETLLHSIRLLEALLAIFLHSARTNQQKMESELPNQNLSVENILC
EMRDHLSQSKVTETELAKPLLDALLRVALGNHSTDFECNDAVTEKSHQSEEEVLSQPGDF
SEETEDSQCCNLKLLVEEEGYEADSESNPEDSETRNDGMYLKPETEDFSAKVHPNDLMEN
LTQGEIIYPEICMLELNLLSASKAKLDVLAHVFESFLKIIRQKEKNIFLLLQQGTVKNLL
GGFLNILTQADSDFQACQKVLVDLLVSLMSLRTSSEELTLLLRIFLEKSPCTEILLLGIL
KIVESDVTMSPSQYLTFPLLHTPSLSNSVSSQKCPGSLNSKAMGLLRKARISRGRKEADR
ASFPHRLLSSWHIAPVHLPLLGQNCWPHLSEGFSVSLWFNVEYIHESEGGNRSILQDSSF
DGSGIDLPKLLTIFSPKIYYTFDSCYLILHFPCCLTLFTVFFIKSVCTDSNDDMKAVLLA
QVESQENVFIPSKWQHLVLTYLQQPQGKKNVSGKISIWVSGQRKPDVTLDFTLPRKTSLS
SDGNKTFCMIGHCLSSQEDFLQLAGKWDLGNLLLFNGAKIGSQEAFYLYACGPNYTSIMP
CKYGKPVNDYSKYINKDILRCEQIRELFMSKKDVDIGLLIESLSIVYTTYLPAQYIIYEP
VIRLKSHVKTQLSQRPFSSKEIQSMLLEPPQIKSLQPTECNTIQGILHEIGGTGIFVFLF
ARVVELSDCEETQALALRVILSLIKYNQQRMHELENCNGLSMIHQVLIKQKCIVGFHILK
TLLEGCCDEEIIYINENGEFKLDVESNAIIQDVKLLEELLLDWKIWNKAQQGVWETLLAA
LEVLIRVEHHQQWFNIKQLLKAQAVHHFLLTCQVLQEHKEGQLTSMPREVCRSFVKIIAE
VLGSPPDLELLTIIFSFLLAVHPPTNTYVCHNPTNFYFSLHIDGKIFQEKVQSIMYLRHT
SSGGRSLTSPGYMVISPSGFTASPPEGSNFSNIIPPGMAAHMLRSRSLPAFPTSPLMQPQ
KLTGSLGCSIDKLQNIVDTYIATQAEKQNPLGSSDILQASKEDAFISSCESAKAVCEADA
VPTTQTPASGVPKGTLGFPMGRVDHKDLEAEHRSDDDSPGDESCLRRPDNLKGLASFQQS
HSTIASLGLAFPSQNGAATVARWPSLVDRNTDDWENLAFSLGYEPNYNQATSAHSVTEDC
LVPICCGLYELLSGILLILPDVMLEDVMDKLIQADTLLVLVNHPSPAIQQGVIKLLHAYF
NRASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFIEMFFGRRISLDEEFDLEDVKNM
GLFQKWSAIPILGLIETSLYDNILLHNALLLMIQILNSCSKVADMLLDNGLLYVLCNTVA
ALNGLEKNIPLNEYKLLACDIQQLFIAVTIHACSSSGSQYFRVIEDLIVLLGYLQNSKNK
KTQSMALALQLRVLHAALEFIKSTANHDSENLEDSIQSPCTSHHAVVQKRKSIAGPRRFP
LAQTESLLMKMRSVASDELHIMMQRRMSQENPSQATDAELAQRLQRLTVLAVNRIIYQEF
SSDIIDILGTPENATQSKTSVFQTEISEENTHHEQPSVFNPFQKEMFTYLIEGFKVYIGS
SKTSGSKQQWTKILWSCKETFRMQLGRLLVHILSPAHTVQERKQIFEILHEPNHQEILRD
CLNQSLQHGAKLVLYLSELIHNHENELTGEELGTADLLMGALKLCGHKCIPPSASSKPDL
VNMIKEEQKKYETEESVNKASWQKTVNNNQQSLFQRLDSKSKDISKIAADITQAVSLSQG
IERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRCRAVWYDPIYYPTSWQLDPTEGPNR
ERRRLQRCYLTIPNKYLLRDRQKSEDVIKPPLAYLFEDKTHSSFSSTVKDKAASESIRVN
RRCISVAPSREIAGELLLGKCGMYFVEDNASDAVESSSLQGELEPASFSWTYEEIKEVHK
RWWQLRDNAVEIFLTNGRTLLLAFDNTKIRTFLFKEKFTPNIPSYFNYNCPPQIGLGLGI
SQEIRFHLIHLSILKKQMAHSFCLRQEKIFFLLKNIYMHSLSINHPFLYRNLSKPIAVQY
KEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFTKMF
LAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGVRQN
GERVNHVNLPPWARNDPRLFILIHRQALESDHVSQNICHWIDLVFGYKQKGRASVQAINV
FHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFHTAHASRPGGKLNIEGELPAAV
GLLVQFAFRETREQVKEITYPSPLSWIKGLKWGEYVGSPSAPVPVVCFSQPHGERFGSLQ
ALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAILSWGYADNILRLKSKQSEPPV
NFIQSSQQHQVTSCAWVPDSCQLFTGSKCGVITAYTNRFTSNTPSEIEMETQVHLYGHTE
EITSLFVCKPYSILISVSRDGTCIVWDLNRLCYVQSLAGHKSPVTAVSASETSGDIATVC
DSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEGVSINVIAGGLENGIVRLWSTW
DLKPVREITFPKSNKPIVSLTFSCDGHHLYTANSEGTVIAWCRKDQQRVKQPMFYSFLSS
YAAG
Download sequence
Identical sequences ENSCPOP00000010310 ENSCPOP00000010310 10141.ENSCPOP00000010310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]