SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000010669
Domain Number 1 Region: 57-158
Classification Level Classification E-value
Superfamily POZ domain 5.89e-29
Family Tetramerization domain of potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010669
Sequence length 283
Comment (Cavia porcellus)
Sequence
MPHRKERPSGSSLHTHGSAGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTS
KLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGER
IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRG
FSVAASCGGGVDSSQFSEYVLCREERRPQPNPTAVRIKQEPLD
Download sequence
Identical sequences A0A286Y3P3
XP_003467253.1.53824 XP_005002569.1.53824 XP_013005245.1.53824 XP_013005246.1.53824 XP_013005247.1.53824 XP_013005248.1.53824 ENSCPOP00000010669 ENSCPOP00000010669 10141.ENSCPOP00000010669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]