SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010708 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000010708
Domain Number 1 Region: 39-268
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.85e-85
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 286-408
Classification Level Classification E-value
Superfamily Spectrin repeat 5.9e-35
Family Spectrin repeat 0.000000635
Further Details:      
 
Domain Number 3 Region: 522-640
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-29
Family Spectrin repeat 0.00000522
Further Details:      
 
Domain Number 4 Region: 409-517
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-25
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 5 Region: 646-758
Classification Level Classification E-value
Superfamily Spectrin repeat 1.41e-23
Family Spectrin repeat 0.00000267
Further Details:      
 
Domain Number 6 Region: 751-883
Classification Level Classification E-value
Superfamily EF-hand 1.54e-22
Family EF-hand modules in multidomain proteins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010708
Sequence length 911
Comment (Cavia porcellus)
Sequence
MVDYHAANQSYQYGPSSAGNGAGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYER
LASDLLEWIRRTIPWLEDRVPQRTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDTLGNLTHSRREALEKTEKQLETIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALMEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLNHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL
Download sequence
Identical sequences A0A286XH11
XP_003467293.1.53824 XP_005399892.1.28644 10141.ENSCPOP00000010708 ENSCPOP00000010708 ENSCPOP00000010708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]