SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000010730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000010730
Domain Number 1 Region: 12-129,164-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.5e-38
Family Nucleotide and nucleoside kinases 0.000000103
Further Details:      
 
Domain Number 2 Region: 129-165
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000000000602
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000010730
Sequence length 228
Comment (Cavia porcellus)
Sequence
MGDVRADCCGAVIMGAPGSGKGTVSSRIVQHFELKHLSSGDLLRQNMLQGTEIGVLAKTF
IDQGKLIPDDVMTRLALHELKNLTQYNWLLDGFPRTLPQAEALDKAYQIDTVINLNVPFE
VIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQ
TEPVLEYYQKKGVLETFSGTETNKIWPHVYAFLQTKVPQTNQKASVTP
Download sequence
Identical sequences H0VKB1
ENSCPOP00000010730 XP_003472311.3.53824 ENSCPOP00000010730 10141.ENSCPOP00000010730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]