SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000011239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000011239
Domain Number 1 Region: 245-315
Classification Level Classification E-value
Superfamily Homeodomain-like 2.05e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 88-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000346
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 56-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000291
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000011239
Domain Number - Region: 152-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00294
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000011239
Sequence length 388
Comment (Cavia porcellus)
Sequence
MLNGTTLEAAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPA
LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFS
VQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFET
LLQGEYPPQLSYTELAAKSGSLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNEN
EADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKR
VLQVWFQNARAKFRRNLLRQENGGVDKADGASLPAPPSADSGALTPPGTATTLTDLTNPT
ITVVTSVTSNLDSHESGSPSQTTLTNLF
Download sequence
Identical sequences H0VLK0
10141.ENSCPOP00000011239 ENSCPOP00000011239 ENSCPOP00000011239 XP_003474902.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]