SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000011829 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000011829
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-19
Family SPRY domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000011829
Sequence length 171
Comment (Cavia porcellus)
Sequence
PAVQLDTQHRGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGVGVATQK
VNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNG
KSMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
Download sequence
Identical sequences ENSCPOP00000011829 ENSCPOP00000011829 10141.ENSCPOP00000011829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]