SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000011841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000011841
Domain Number 1 Region: 22-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.86e-43
Family Pentraxin (pentaxin) 0.000000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000011841
Sequence length 225
Comment (Cavia porcellus)
Sequence
MAKLLLYFLLLTSLSDVFGGTDMSKKTFVFPKETDNSYVSLKAQLKKPLSAFTVCLHIYT
ELFMTRGYSIFSYATEKEANEILIFWSKDRGYILGVGGIEMPFKAPEIPSAPVHICTSWE
SVSGIIELWVDGKAQVRKSLQKGYFVGTEAMIILGQDQDSFGGSFDANQSFVGDIGDVNM
WDFVLSPKEIDMVYSGGTFSPNVLSWRSLTYETHGEVFIKPQLWP
Download sequence
Identical sequences P49254
XP_003466601.1.53824 ENSCPOP00000011841 10141.ENSCPOP00000011841 ENSCPOP00000011841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]