SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012416
Domain Number 1 Region: 51-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000116
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012416
Sequence length 149
Comment (Cavia porcellus)
Sequence
MALGVPLSVYLLFHALTALTADADWAETSQSNKTTNETQADSVEGPVALKFSHPCLEDHS
SYCINGLCAFHHELDQAICRCYTGYTGERCEHLTLTSYAVDSYDKYIAIGIGAGLLLSGF
LAIFYCYIRKRCLPLKSPYNLCSAGRQPL
Download sequence
Identical sequences XP_003479804.1.53824 ENSCPOP00000012416 ENSCPOP00000012416 10141.ENSCPOP00000012416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]