SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012599
Domain Number 1 Region: 969-1096,1128-1334
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.43e-78
Family p120GAP domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 35-199
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-39
Family Calponin-homology domain, CH-domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 1559-1656
Classification Level Classification E-value
Superfamily RGC domain-like 9.29e-33
Family RGC domain 0.00000187
Further Details:      
 
Domain Number 4 Region: 631-834
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000069
Family Nucleotide and nucleoside kinases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012599
Sequence length 1656
Comment (Cavia porcellus)
Sequence
SAAMSAADEVAARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGED
LPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYRATGLHFRHTDNVIQWLN
AMDDIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEE
INNMKIELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDHRIPADTFTALK
NPNAMLVNLEESLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNIN
KVNILSALANVDLALVQGATLALLKALQSPALGLRGLQQQNGDWYLKQLLSDKQQKQQSG
QLEPLQKEELQAGVDDANSAAQQYQRRLAAVAAINAAIQRGIADKTVMELMNPEAQLPQV
YPFAADLYQKELATLQQQSPEHSLTHPELSVAVEMLSSVALINRALESGDMNTVWKQLSS
SVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDQVNLVVQEEHERILA
IGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQETQDESAVL
WLDEIQGGIWQSNKDTQEAQRFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECG
ETYQSDLAEAKKKKTEAGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPDFVQNSMQLS
REEIQSSISGVTAAYNREQLWLANEGLITRLQACCRGYLVRQEFRSRMNFLKKQIPAITC
IQSQWRGYKQKKAYQDRLAYLRAHKDEVVKIQSLARMHQARKRYRARLQYFRDHINDIIK
IQAFIRANKARDDYKTLINAEDPPMLVVRKFVHLLDQSDQDFQEELDLMKMREEVITLIR
SNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKAL
SKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYL
LLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIMD
EKSLNIKTDPVDIYKAWVNQMESQTGEASKLPYDVTPEQALVHEEVKTRLDNSIRNMRAV
TDKFLSAIISSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAIV
APDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQK
FRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHN
DPIHELLDDLGEVPTIESLIGESVGSLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDA
RTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEADHQRAMQRRAIRDAKTPDKMKKS
TSVKEDNSLSLQEKKEKIQTGLKKLTELGTVDPKNRYQELINDIARDIRNQRRYRQRRKA
ELVKLQQTFAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISL
KYTAARLHEKGVLLEIEDLQVNQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQD
LLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences ENSCPOP00000012599 10141.ENSCPOP00000012599 ENSCPOP00000012599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]