SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012929
Domain Number 1 Region: 140-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.95e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012929
Sequence length 374
Comment (Cavia porcellus)
Sequence
KMSSALENGRSPAPEKSEFRSRKPKPENRDESELLTVPDGWKEPAFSKEDNPRGLLEESS
FATLFPKYREAYLKECWPLVQKALNEHHINATLDLIEGSMTVCTTKKTFDPYIIIRARDL
IKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLT
NCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKTLMIKRELAKDSELRSQSW
ERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFMKANQKKRQKM
EAIKAKQAEALSKRQEERNKAFIPPKEKPAAKPKEAPTETKIDVATIKEKVKKAKNKKLG
ALTDEEVKLKLEVD
Download sequence
Identical sequences 10141.ENSCPOP00000012929 ENSCPOP00000012929 ENSCPOP00000012929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]