SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013260
Domain Number 1 Region: 13-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.39e-56
Family G proteins 0.00000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013260
Sequence length 217
Comment (Cavia porcellus)
Sequence
MQFPSAARAADEDVDYLFKVILIGDSNVGKTCVVQHFRSGVYTETQQNTIGVDFTVRSLD
IDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEVEKYGA
ANLVIMLIGNKSDLWQQRHVLFEDACTLAEKHGLLAVLETSAKESRNIDEVFVLMAKELM
ARNRLQLDSESTMHSLAPESSPVLLAQVPCEKPCCSC
Download sequence
Identical sequences A0A286XVS1
ENSCPOP00000013260 10141.ENSCPOP00000013260 ENSCPOP00000013260 XP_003475518.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]