SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013327 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013327
Domain Number 1 Region: 45-155
Classification Level Classification E-value
Superfamily POZ domain 3.14e-32
Family BTB/POZ domain 0.01
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000013327
Domain Number - Region: 5-29
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0131
Family MATH domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013327
Sequence length 235
Comment (Cavia porcellus)
Sequence
INRLNATNGLLPDDKLTLFCEVKVTQDTTDSFSLNNKNIVKACENWLASDLAGLWKNSLL
ADCCFFVAGQEFQAHKAILAARSPVFKAMFQHEMQESKNNRVEISDMEPEVFKEIMFFMY
TGKAPDLGRMAPDLLAAADRYGLGCLKLMCEKHLCCNLSVKNVIKILILADFHSVHQLKV
CAVDFINLHISDILETEEWKSLVVSHPHLVAEAYQSLASMHCAFLGPPYKRVRLS
Download sequence
Identical sequences ENSCPOP00000013327 10141.ENSCPOP00000013327 ENSCPOP00000013327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]