SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013833
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.09e-36
Family Thioltransferase 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013833
Sequence length 105
Comment (Cavia porcellus)
Sequence
MVQQIESKEAFQEALNDAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD
DCQDVAAECEVKCMPTFQFFKKGKKVSEFSGANKEKLEATINELV
Download sequence
Identical sequences H0VT53
ENSCPOP00000013833 XP_003463829.1.53824 ENSCPOP00000013833 10141.ENSCPOP00000013833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]