SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000014392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000014392
Domain Number 1 Region: 319-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.93e-29
Family SPRY domain 0.057
Further Details:      
 
Domain Number 2 Region: 155-305
Classification Level Classification E-value
Superfamily ARM repeat 0.00000096
Family HspBP1 domain 0.076
Further Details:      
 
Domain Number 3 Region: 517-568
Classification Level Classification E-value
Superfamily RING/U-box 0.00000152
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000014392
Sequence length 576
Comment (Cavia porcellus)
Sequence
MIVFGWAVFLASRSLGQGLLLTLQEHIANLVGTRGAAATMGNSCICRDDSGAEDSVDTHQ
QQSDNSAVPTADMRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSGHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLVTLESWADEPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVDLSSIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDSGV
WYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHVHP
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGA
KPFKYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLK
PCGHSDLCMDCALQLETCPLCRKEIVSRVRQISHIS
Download sequence
Identical sequences H0VUL8
XP_003472120.1.53824 XP_013010267.1.53824 XP_013010268.1.53824 10141.ENSCPOP00000014392 ENSCPOP00000014392 ENSCPOP00000014392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]