SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000015201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000015201
Domain Number 1 Region: 300-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-54
Family SPRY domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 13-88
Classification Level Classification E-value
Superfamily RING/U-box 8.84e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 105-163
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000122
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000015201
Domain Number - Region: 149-231
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0183
Family Apolipoprotein A-I 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000015201
Sequence length 484
Comment (Cavia porcellus)
Sequence
AATQLICSDANSMELAAALADLQAEASCPICLGYLKSPVTIYCGHNFCLACITESWKDLK
GSFPCPSCHFVCPNKKFQNNFQLGNLTEIAKLLPLRRSKRKKQEGSLMCETHKQVLTVFC
QKDLEVLCPQCSFSADHQQHYIWPIEKAADYHRKQLARHIELWKEKVEQIDKVIAMQTGK
SEELKKKVEHRREEIKSEFEQFMLFLQNEHEAVVRQLQDEENELLAKLNENVADTSDHAS
ASKCLLKEIESKYVKSEVEVLTSVKSIYRRYRSLKCPEMFSFQFRDYVYQLPPQYSGLNR
IIKQFHVDVVLDPETAHRKLIISEDRKSVRYGNMQKLPHSPQKFYIWPAVLGARSYSSGR
QYWEVEVKDKPEWILGICTAALPRRRKNQNQPFLVKAGLWGIGRCSHTSYIAFGPKKVNL
LPKVIPIKIGIFLDCEMGEVSFYNLSDRSLLHTFNDYFGGPVWPYFYTGTESRPLRICTV
TESE
Download sequence
Identical sequences ENSCPOP00000021073 ENSCPOP00000015201 10141.ENSCPOP00000015201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]