SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000015569 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000015569
Domain Number 1 Region: 319-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-37
Family SPRY domain 0.00042
Further Details:      
 
Domain Number 2 Region: 32-140
Classification Level Classification E-value
Superfamily Immunoglobulin 9.48e-18
Family V set domains (antibody variable domain-like) 0.00027
Further Details:      
 
Domain Number 3 Region: 116-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000278
Family C1 set domains (antibody constant domain-like) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000015569
Sequence length 548
Comment (Cavia porcellus)
Sequence
MEDSCSCCRLCCLLSLLLLVQLPNWASTEEFQVLGPPEPIVAVLGGDATLSCSVSPAMDV
RNMELRWFRTTLTESVFVYRNQREQTEEQTAEYAGRTSLLLAHGEAALNIHKVRVSDNGM
YNCFFKMGSFSEDASLELQVAGVGSAPQVHIQGPEEDGVRVVCRASRWFPKPQVQWRDVS
GKKILAFSEAHTQDADLLFSVEATVVVREASVGNVTCSVLNPVLGQQKAMAIFIPEPFFP
QASPWKPAFAVSLTVMGLLLFGAGYFLHTQHSRKLQIQQTLKNLRLAKEEDRRIKEQALK
AKDELQAELGQRKAAYKAAWRKAQLYPDWRKEQFQALSVTLDPGSAHKSISISHGKTRLT
CVYPGGDDLCSVLGHEGITAGRWCWEVEIMSGENGEWALGVCREDANRAGWYLESVDKGF
WVVEWVKPGHFTYITSDTLFPGKPSEACCRLGVFLDYSEGDLSFYDMTAGSGTLFPYFSF
KRGTVSLTICPAESGSLGHPAALHNNCPSLKETLKSSGEGLGSGSEEGEVAQGAESPLLS
RDLGAVIP
Download sequence
Identical sequences ENSCPOP00000015569 ENSCPOP00000015569 10141.ENSCPOP00000015569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]