SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000015682 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000015682
Domain Number 1 Region: 31-151
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.03e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000015682
Sequence length 320
Comment (Cavia porcellus)
Sequence
SEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLK
RLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMS
HALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRVAPTAPSRGRGGA
IPLPPPPGRGVLTPRGTTVTRGALPVPPIARGVPTPRARGAPTVPGYRAPPPPAHEAYEE
YGYDDGYGEEYEEQTYQAYDHSYAPQTQSVPEYYEYGHGVNEDAYDSYATEEWATTRSSL
KAPPPRSTRGGYREHPYGRY
Download sequence
Identical sequences 10141.ENSCPOP00000015682 ENSCPOP00000015682 ENSCPOP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]