SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000015741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000015741
Domain Number 1 Region: 14-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1040-1152
Classification Level Classification E-value
Superfamily E set domains 1.27e-35
Family Filamin repeat (rod domain) 0.00000229
Further Details:      
 
Domain Number 3 Region: 1328-1440
Classification Level Classification E-value
Superfamily E set domains 2.87e-35
Family Filamin repeat (rod domain) 0.000019
Further Details:      
 
Domain Number 4 Region: 1518-1636
Classification Level Classification E-value
Superfamily E set domains 2.94e-35
Family Filamin repeat (rod domain) 0.00000286
Further Details:      
 
Domain Number 5 Region: 1442-1551
Classification Level Classification E-value
Superfamily E set domains 5.6e-33
Family Filamin repeat (rod domain) 0.0000184
Further Details:      
 
Domain Number 6 Region: 1856-1950
Classification Level Classification E-value
Superfamily E set domains 8.67e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 7 Region: 1142-1250
Classification Level Classification E-value
Superfamily E set domains 9.34e-31
Family Filamin repeat (rod domain) 0.0000472
Further Details:      
 
Domain Number 8 Region: 452-570
Classification Level Classification E-value
Superfamily E set domains 1.27e-30
Family Filamin repeat (rod domain) 0.00066
Further Details:      
 
Domain Number 9 Region: 2040-2133
Classification Level Classification E-value
Superfamily E set domains 2.56e-30
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 10 Region: 1239-1349
Classification Level Classification E-value
Superfamily E set domains 2.07e-29
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 11 Region: 668-764
Classification Level Classification E-value
Superfamily E set domains 6.14e-29
Family Filamin repeat (rod domain) 0.00046
Further Details:      
 
Domain Number 12 Region: 856-967
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Filamin repeat (rod domain) 0.00059
Further Details:      
 
Domain Number 13 Region: 2313-2404
Classification Level Classification E-value
Superfamily E set domains 4.74e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 14 Region: 754-866
Classification Level Classification E-value
Superfamily E set domains 8.67e-27
Family Filamin repeat (rod domain) 0.00083
Further Details:      
 
Domain Number 15 Region: 2635-2725
Classification Level Classification E-value
Superfamily E set domains 2.8e-26
Family Filamin repeat (rod domain) 0.00000328
Further Details:      
 
Domain Number 16 Region: 274-370
Classification Level Classification E-value
Superfamily E set domains 8.67e-26
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 17 Region: 560-661
Classification Level Classification E-value
Superfamily E set domains 1.47e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 18 Region: 1625-1738
Classification Level Classification E-value
Superfamily E set domains 1.6e-25
Family Filamin repeat (rod domain) 0.0000589
Further Details:      
 
Domain Number 19 Region: 374-474
Classification Level Classification E-value
Superfamily E set domains 3.2e-25
Family Filamin repeat (rod domain) 0.00084
Further Details:      
 
Domain Number 20 Region: 2504-2596
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.00000308
Further Details:      
 
Domain Number 21 Region: 2411-2501
Classification Level Classification E-value
Superfamily E set domains 2.54e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 954-1055
Classification Level Classification E-value
Superfamily E set domains 6.52e-22
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 23 Region: 2246-2327
Classification Level Classification E-value
Superfamily E set domains 8.01e-20
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 24 Region: 1958-2054
Classification Level Classification E-value
Superfamily E set domains 2.34e-18
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 25 Region: 1792-1872
Classification Level Classification E-value
Superfamily E set domains 6.67e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000015741
Sequence length 2726
Comment (Cavia porcellus)
Sequence
MMNNSGYPDASGFGLGDEADEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVQNAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFT
VQTVDAGLGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RQDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGSPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEELVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGTQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGSGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
HYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFIVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPIPKFPTRVHVQPAIDTSGVKVSGPG
VEPHGVLREVTTEFTVDARSLTAVGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLESGLVNKSNRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLSPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLP
HVEEPSEVLSLRQPYTPPRPGTCPTHWATEEPVVPVEPLESMLRPFNLVIPFTVQKGELT
GEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINS
RHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYL
PTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTA
SIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKGGKHVTNSPFKILVGPSEIG
DASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVT
YCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFP
AVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFV
PQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWT
REAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVV
PVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSEL
DSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGT
TGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGG
PQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSHGSSYSSIPKFSSDASKVV
TRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHIGNRVYNVTYTVK
EKGDYILIVKWGDESVPGSPFKVNVP
Download sequence
Identical sequences A0A286XTW0
ENSCPOP00000015741 XP_003475226.1.53824 10141.ENSCPOP00000015741 ENSCPOP00000015741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]