SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000016115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000016115
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-63
Family SPRY domain 0.0000000179
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000366
Family SOCS box-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000016115
Sequence length 273
Comment (Cavia porcellus)
Sequence
MGQKLSGGLKSVEVREPALRPAKRELPGAEAGRPARLDQLLDMPAAGSAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIDWPARQRGTHAVVGVATS
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNRPGVAYPAFLGPDEAFALPDSLLVV
LDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ
Download sequence
Identical sequences H0VZI2
ENSCPOP00000016115 XP_003476798.1.53824 XP_013015014.1.53824 ENSCPOP00000016115 10141.ENSCPOP00000016115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]