SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000016937 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000016937
Domain Number 1 Region: 30-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-37
Family Laminin G-like module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000016937
Sequence length 1730
Comment (Cavia porcellus)
Sequence
MERGNRCHRLLLLLPLVLGLSAARGWAGAPPVDVLRALRFPSLPDGVRRARGICPEDMAY
RVSRPAQLSAPTRQLFPGGFPQDFSLLTVVRTRPGLQVSLLTLYSAQGIQQLGLELGRPV
RFLYEDQTGRPQPPAQPVFRGLSLTDGKWHRVAVAVKGQSVTLIVDCKKRITRPLPRSAR
PVLDTRGVVIFGARILDEEVFEGDVQELLVVPGVQAAYESCEQKDLECKESQSERPQGKP
SHRAQRSPQQPPSGLHRPQNQEPQRQSGESLYYDYEPPYYDEMTTGTTPDYQYPTPGEEE
GVLESSPLPLPEEEEAELQVPPTADGFLAEHYGEGGTGAPAGLYDYTYGYGDDYREETEL
GPALSAETARPGAVARGPRGLKGEKGEPAVLEPGMLVEGPPGPEGPAGLAGPPGIQGNPG
PVGDPGERGPPGRAGLPGSDGAPGPPGTSLMLPFRFGSSAGDKGPVVAAQEAQAQAILQQ
ARLALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLAGPPGKAGRRGRA
GADGARGMPGEPGVKGDRGFDGLPGLPGEKGHRGDTGAQGLPGPPGEDGERGDDGEIGPR
GLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPQGPKGSLVSSGCGGPAPSPQGLPGPQGA
IGPHGEKGPQGKPGLPGMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGV
DGIQGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGP
PGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKAGPRGERGPTGP
RGQRGPRGATGKSGAKGTSGGDGPHGPAGERGLPGPQGPNGFPGPKGPPGPPGKDGLPGH
PGQRGEVGFQGKTGPPGPPGVVGPQGAAGESGPMGERGHPGPPGPPGEQGLPGTAGKEGT
KGDPGTPGAPGKDGPAGLRGFPGERGLPGTPGGPGLKGNEGPAGPPGPAGSPGERGAAGS
GGPIGPPGRPGPQGPPGAAGEKGVPGEKGPMGPTGRDGVQGPVGLPGPAGPPGVAGEDGD
KGEVGDPGQKGTKGNKGEHGPPGPPGPIGPVGQPGAAGADGEPGARGPQGHFGAKGDEGT
RGFNGPPGPIGLQGLPGPSGEKGETGDVGPMVSVTPPSPSPIAPNGADGPQGPPGGVGNL
GPPGEKGEPGEPGSPGVQGEPGVKGPRGERGEKGESGQAGEAGPPGPKGPTGDDGPKGNP
GPVGFPGDPGPPGEVGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKRGPAGTP
GPEGRQGEKGAKGDPGAVGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGRPGATGLA
GPPGPLGPPGLPGLRGDAGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGAAGQKGET
GIPGASGPIGPGGPPGLPGPAGPGDSCDPSGPAGPKGEKGVQGPPGHPGPPGEVIQPLPI
QMPKKTRRSVDGSRLMQEDEAVPTGGAPGSPAGLEEIFGSLDSLREEIEQMRRPTGTQDS
PARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVTQFSYVD
AEGAPVGVVQLTFLRLLSVSAHQDVSYPCSKVSPDSPLRLRGANEDELSPDTSPYVKEFR
DGCQTQHGRTVLEVRTPVLEQLPVLDASFSDLGSPPRRGGVLLGPVCFMG
Download sequence
Identical sequences ENSCPOP00000016937 10141.ENSCPOP00000016937 ENSCPOP00000016937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]