SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000017508 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000017508
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily SNARE-like 1.01e-28
Family Synatpobrevin N-terminal domain 0.0073
Further Details:      
 
Domain Number 2 Region: 120-186
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.04e-19
Family SNARE fusion complex 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000017508
Sequence length 219
Comment (Cavia porcellus)
Sequence
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICDRIV
YLCITDDDFERSRAFNFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENK
GLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARA
MCMKNIKLTIIIIIVSIVFIYIIVSSLCGGFTWPSCVTK
Download sequence
Identical sequences ENSCPOP00000017508 10141.ENSCPOP00000017508 ENSCPOP00000017508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]