SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018089 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018089
Domain Number 1 Region: 32-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-60
Family Calnexin/calreticulin 0.00016
Further Details:      
 
Domain Number 2 Region: 203-316
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.27e-41
Family P-domain of calnexin/calreticulin 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018089
Sequence length 367
Comment (Cavia porcellus)
Sequence
HVLPLPLLLRLLLNLFFGEDAVVFSLSLWSVDGWKNRWVQSKHQPDYGQFQLSAGQFYGH
VEKDKGLQTTEDAKFYALSTRFKPFSNENETLVVQFSVKHEQGIDCGGGYVKLFPATLNQ
EDMHSESEYYIMFGPDICGFGNNFVQVILQYQGKYHANNKTIKCRINKDTHLYTLVIHPN
ATYAVKIDNEQVTAGELEDDWAFLPPRRIKDPYARKPRKWDERLQIEDPKDKKPEDWEDS
EFIPDPDAKKPADWNEAIDGEWEGPLIPNLKYKGQWKPRIIDNPNYQGEWIHPEIDNPEY
KPDPSLGHYYNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNKTWGIRKEAQMKRLT
QQIEELR
Download sequence
Identical sequences 10141.ENSCPOP00000018089 ENSCPOP00000018089 ENSCPOP00000018089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]