SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018261 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018261
Domain Number 1 Region: 566-721
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-34
Family MAM domain 0.001
Further Details:      
 
Domain Number 2 Region: 883-1048
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-32
Family MAM domain 0.0021
Further Details:      
 
Domain Number 3 Region: 62-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-30
Family MAM domain 0.011
Further Details:      
 
Domain Number 4 Region: 723-881
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-28
Family MAM domain 0.0014
Further Details:      
 
Domain Number 5 Region: 270-420
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-20
Family MAM domain 0.0087
Further Details:      
 
Domain Number 6 Region: 226-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 7 Region: 483-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000237
Family MAM domain 0.027
Further Details:      
 
Domain Number 8 Region: 449-487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000432
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018261
Sequence length 1130
Comment (Cavia porcellus)
Sequence
MLLPAYLLPALVLLTAQSLGRAWNPGPCQSPIEAQCNFLCDCSDCSDESQCGYNGAPPGP
GAPFTCDFEQDPCGWQDISTSGYSWVRNRAGAQAEGPVAHTDHTRGTDLGWYIGVGTHRG
TESSSAVLRSPVLRNAGPACELRLWYHTASGDVAELQLELTHSAETLTLWQSLGPWGRGW
QELAVTTGRIQGDFQVTFSVTRNATHRSAVALDDVEFWDCGLPTSQAICPQGYHHCKNAA
CIEPHQLCDGEDNCGDGSDEDPLTCSHHTGTDFETGLGPWSHSEGPAWNLSTGLPKGSAW
PHRDHSRNSAKGSFLVTTAKPGNPAILLSPQLQASNSHNCSLIFYHYLHGSEAARLELFL
QTEGPRAPVLLRQRYGELGAAWVRDRVDIQSAHPFRILLTGEVGPGGVVGLDDLILSDHC
MMDPGDLLSLPPVPWLKAPHAQQSSLQGSCKPGQLACGELCVPLEQLCDFQPQCALGEDE
LKCGTTDFESTTVGGWEDASIGRLQWRQWAAPESSWPGRPAAGHFLSLQRAWGQLRPEAR
ARTPVLGPSGLHCELHMAYYFHSHPREVTCNFERDMCGWHQSHLTDVHWRRVESHNSGYD
HTTGQGFFMLLDPTEPLTHGHHAYLLTGPQVPTAPEQCLSFWFYLHGPQIGTLQLALRRD
GQDIKLWSESGTHGNRWHQAWATLHHQMEPGSKYQLLFQGLRDGYEGIMALDDVTIRPGT
CPPPWRCSFEDSACSFSSGGQGLWRRQANALGHSAQGPWTDHTTETAQGHYMVVDTSPDV
LPQGHMASLTSEEHWPLLHPACLTFWYHLSARSPGTLQVRVEEAKWRQTLSISEPGGPAW
RLGSMDVRAKQAWRVVFEAVATGMQHSYIALDDVLLQDGPCPQPGSCDFESGLCGWSHLP
WPGLGGYSWDWSSGAAPSRYPRPPVDHTLGTEAGHFIFFETGVLGPGGRAAWLRSEPLPA
TKVSCLRFWYYMGFPEHFYKGELHVLLVSIRGQLAVWAKGGRLRHQWLEAQVEVASTEEF
QVVFEATLGSQPAQGPIALDDIEYLSGQRCQRPTLSPEDTAVPVSVEATVSGALIFLMLL
VLLGLAGWHWLQKGGGWPSWRSRDSAPSSFDNILFNADQVTLPAAVTRDP
Download sequence
Identical sequences 10141.ENSCPOP00000018261 ENSCPOP00000018261 ENSCPOP00000018261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]