SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018420
Domain Number 1 Region: 920-1047,1079-1283
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-78
Family p120GAP domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 1514-1612
Classification Level Classification E-value
Superfamily RGC domain-like 4.97e-33
Family RGC domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 1-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.46e-33
Family Calponin-homology domain, CH-domain 0.0000522
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000018420
Domain Number - Region: 730-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0181
Family Motor proteins 0.054
Further Details:      
 
Domain Number - Region: 633-663
Classification Level Classification E-value
Superfamily WW domain 0.0263
Family WW domain 0.0044
Further Details:      
 
Domain Number - Region: 415-491
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 0.0471
Family PPK N-terminal domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018420
Sequence length 1612
Comment (Cavia porcellus)
Sequence
RWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFR
HTDNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDL
LGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANELSVDEAALHAAVIAINEAIEKG
IAEQTIVTLRNPNAVLTLVDDDLAQEYQKELWGAKRKKEDNAKLKVLNSNPKEERDAYEE
LLTQAEIQGSIDKVNRRALAIFGGFKNALNMIKAFALYLMLHSVRAGLDILLNAEYDKMV
KKKFSEVKEDKLSSCQRIRKSQLQSSHALADGAALGYLRGLAAVDHINAVLRKGDPEHTL
QALKKPEAQLPTVYPFAAVMYQSELFNLQTQNPTNYLAHEELLIAVEMLSAVALLNQALD
SNDLMSVQNQLRSPSIGFNNLDEAYVERYANALLSFKLEASSQGQDNLSWNEIQNCIDMI
NAQIQEENDRIVAVGYINEAIDEGNPLKTLDTLLLPTAKIRDVDPAHAQHYQDVLHYAKS
QKIMDAESVSKVLWQDEIQQAIHEANLDEERAKQWAMLVIDINRCLEEQKSGDILPALKS
SPSHAQDVIFECADRYYKALRKAKESKSKKVITEGSWLKFNLRDKYDYYYNIDSKEGSWV
PPESWAPKESWLTGKEIEDIVEEVTVRYIREKMWSASEDLLLRFQATSSGPMLKAEFEAR
KSFLSDQEENVVKIQAFWKGHKQQKEYLLRRQTFADNVDSVVKIQSWYRMATTRKNYLSR
LRYFQDHKNEIVKIQSLLRASKARDDYRTLVGSENPPLTVIRKFVYLLDQSDLDFQEDLE
VARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRITLEDVISHRKKLNKKKGGEMEIL
NNIDNQGIKSLSKEKRKTLETYQQLFYLLQTNPSYLAKLIFQMPQNKSTKFMDTVIFTLY
NYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNTLRQ
LLAPVVKEIIDDKSLVINTSPVEVYKAWVNQLETQTGEASKLPYDVTTEQALTHPEVRNK
LEVSIENLRRVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVGNL
LYYRYMNPAIVAPDGFDIIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFEGENEHLSS
MNDYLSKTYQEFRKYFKEACNVPEPEDKFNMDKYTDLVTVSKPVIYISIEEIINTHSLLL
EHQDAIAPEKNDSLNQLLELLGAAPSVESFLGEGAVDPSDPNKENTLNQLSKTEISLYLT
SKYDIEDGNTVDSRSLMIKTKKLIIDVIRNQPGTTLTEILETPATELQEQDHNRDMASRA
ATDLRAPEDGKQSQTVLEDALLPLEQKKRKIQRNLRTLEQTGHVSSANKYQDILNEIAKD
IRNQRVHRKLRKAELAKLQQTLKALNEKAAFYEEQINYYDTYIKTCVDNLKRKNTRRSIK
LDGKGEPKGVKRVKPVRYTASKLHEKGVLLGIDDLQTNQFKNVTFDIIATEDVGIFDVRS
KFLGVEMEMVQLNIQDLLQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK
Download sequence
Identical sequences 10141.ENSCPOP00000018420 ENSCPOP00000018420 ENSCPOP00000018420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]