SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018495 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018495
Domain Number 1 Region: 17-194
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-40
Family SPRY domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018495
Sequence length 196
Comment (Cavia porcellus)
Sequence
KYIFVKAWRKAQLYPDWRKELFQALSVTLDPGSAHESISISHGNSSLTCEHPGGDDLCSV
LGHEGITAGRWCWELEIQSGENVEWALGVCREDANRAGWYGELVDKGFWVVEWVKTGHIT
SVKPNIDVKPNISEPSKACWRVGVFLDYSEGDLSFYDMTAGSHMFSFLQAPFSGTLFPYF
SFKCGTVSLTICHPES
Download sequence
Identical sequences ENSCPOP00000018495 ENSCPOP00000018495 10141.ENSCPOP00000018495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]