SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018949
Domain Number 1 Region: 111-190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000112
Further Details:      
 
Domain Number 2 Region: 206-298
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000128
Further Details:      
 
Domain Number 3 Region: 400-491
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.2e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000148
Further Details:      
 
Domain Number 4 Region: 299-390
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018949
Sequence length 676
Comment (Cavia porcellus)
Sequence
MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGY
GGQKRPLEDGDGSWTSPSSTTHWEGMPSPFKDQPDAKKVAPQNDSFGSQLPPMHQQQSRS
VMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQS
AKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKM
VMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGID
VPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPDRIAQITGPPDRCQHAAEII
TDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETI
KSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVP
HGPHGVPGPHGPPGPPGPGAPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQ
QAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPTGAPTATQTNGQGDQQNPAPAGQ
VDYTKAWEEYYKKMGQAVPAPAGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPP
APQGFANHARSHHHLY
Download sequence
Identical sequences ENSCPOP00000002503 10141.ENSCPOP00000018949 XP_012998240.1.53824 ENSCPOP00000018949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]