SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019841
Domain Number 1 Region: 222-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.2e-43
Family Pentraxin (pentaxin) 0.00072
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000019841
Domain Number - Region: 155-234
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.00628
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019841
Sequence length 425
Comment (Cavia porcellus)
Sequence
MLALLAAGVAFAVVVLAQDKPLPGSHFVCSAIPPEALFAGCPLPATPMQGVSLSPEEELR
AAVLQLRETVVMQKETLGAQREAIRELTSKLARCEGLMAGKAESSKDTMATCRGTLSRVV
EQLSRCRVLKDRESLELQLRTNASNTGLPSDFREVLQRRLGELERQLLRKVAELEDEKSL
LHNETSAHQQKTENTLNALLQRVTELERGNSAFKSPDAFKVSLPFRTNYLYGKIKKTLPE
LYSFTICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQLPLFVSD
GKWHHICITWTTRDGLWEAFQDGEKLGTGENLAPWHPIKSGGVLILGQEQDTVGGRFDAT
QAFVGELSQFNIWDRVLRPQEISNIANCSLNMAGNIIPWVDNNVDVFGGASKWPVETCEE
RLLDL
Download sequence
Identical sequences 10141.ENSCPOP00000019841 ENSCPOP00000010912 ENSCPOP00000019841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]