SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020088
Domain Number 1 Region: 122-302
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-31
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 330-506
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000127
Family Nucleotide and nucleoside kinases 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020088
Sequence length 720
Comment (Cavia porcellus)
Sequence
GGVSGLEPPGPHVMDNITRQNQFYETQIIKQENESGYDRRPLDMEPLQQTYRPEVKTEMK
QEAPPSFLPPEASQHKPDRQQFQSRKRPYEENRGRGYFEHREDRRGSPQPPAEEDEDDFD
DTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAHLWSGARASYGVRRGRVCFEMKINEEI
SMKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTRKKSTNSRFENYGDKFAEND
VIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRT
EPYCSVLPGFTFIQHLPLSERIQGAVGPKSKGECEILMMVGLPAAGKTTWAIKHAASNPS
KKYNILGTNAIMDKMRVMGLRQQQNYTGCWDVLIQQATQCLNRLIQIAARKKRNYILDQT
NVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTW
PDVGDFLDEVLFIELQREEADKLVRQCNEEGRKAGPPEKRFDNRGGGFRGRGGGGGFQRY
DNRGPPGGNRGGFQNRGGGSGGGNNYRGGFNRSGGGGYNQNRWGNNNRDNNNSNNRGSYS
RAPPPSYSPARNPPGPGSYNKNSNIPGSGANTSTTTVSSYSPRLHSPAYNYGSYGGYNPA
PYTPPPPPTAQTYPQPSYNQYQQYVQQWNQYYNQGQWPPYYGNYDYGSYSCSTQGGTSTQ
Download sequence
Identical sequences 10141.ENSCPOP00000020088 ENSCPOP00000020088 ENSCPOP00000020088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]