SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020704
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.26e-16
Family Canonical RBD 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020704
Sequence length 184
Comment (Cavia porcellus)
Sequence
LQKLCIGGLSFDKTRKRLRSHSEKVATRDPNTKGCRASRFVTYASMEEVDTALKARLHKV
DGTVMELKEDSQSPGAHLTVKIFVDGIKEDTEEHHLEIILNSMEKLTDRGSEKKRGFAFV
TFDDHDCVDKIVIQKYHTVNNHNCEVRKLYQSRVWLVLHLAKEVQVALEILVVVMEVVLV
AMTV
Download sequence
Identical sequences 10141.ENSCPOP00000020704 ENSCPOP00000020704 ENSCPOP00000020704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]