SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020733 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020733
Domain Number 1 Region: 421-605
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.06e-38
Family Pentraxin (pentaxin) 0.00073
Further Details:      
 
Domain Number 2 Region: 6-65
Classification Level Classification E-value
Superfamily Chromo domain-like 1.05e-17
Family Chromo domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020733
Sequence length 618
Comment (Cavia porcellus)
Sequence
MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK
ERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLK
KDIRRCHRMPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKVPSRNRVIGKSKKFSE
SILRTQIRHMKFGAFALYYDARSSGSSGCPSPAPQSSSDPDDTPPKLLPETVSPSAPEWR
EPEVLDLSIPPEAAASSKRAPPSDVAPAAVQALPAAPEPTGASSEPEAGDWRPEMSPCSN
VVVTDVTSNLLTVTIKEFCNPEDFEKQELPARVNLSAAPAPAPAVPTALHSKMDELEGQL
LAKVLALEKERAALSHSSHQQRQEMEQELDALQGRVAELEHGSSAYKPPDAFKVSIPIRN
NYMYARVRKALPELYAFTACMWLRSRSGGTGQGTPFSYSVPGQANEIVLLEAGHEPMELL
INDTVAQLPMSLKDNSWHHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILIL
GQEQDTLGGRFDATQAFVGDIAQFNLWDHVLTPAQVLGIANCTAPLLGNVLPWEDKLVET
FGGATKAAFDVCKGRAKA
Download sequence
Identical sequences 10141.ENSCPOP00000020733 ENSCPOP00000020733 ENSCPOP00000020733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]