SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020762
Domain Number 1 Region: 27-205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-59
Family SPRY domain 0.00000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020762
Sequence length 212
Comment (Cavia porcellus)
Sequence
DKLQQEIDDRKAQFENGWQNSHLFPDWRKKYYQAANVTLDPDTAHPALILSEERQVSMGE
KPQDLPRNQMRFESLPCVLGKQSFSSERHFWEVKVNSCTGWDLGICRSNVMRKERTYIKP
EDGFWAIRMYNHEYWALTSPETQLTLKQHPCTICIFLDYEDQRISFYNMEDNSHIYTFSQ
GAFYGSLRPFFRLWFKDSGHLYICPLSKEPEA
Download sequence
Identical sequences ENSCPOP00000020762 10141.ENSCPOP00000020762 ENSCPOP00000020762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]