SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020797 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020797
Domain Number 1 Region: 15-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-37
Family Pentraxin (pentaxin) 0.000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020797
Sequence length 211
Comment (Cavia porcellus)
Sequence
VLTELLPHCLSSADLRGKVLIFPQESATAYVSLIPSVKKPLQNFTLCLKSFTDLNRAYSL
FSYSTRSRDNELLLFIEKTGEYQLSIGNAGVNFKVPPLPYNPRHICVSWESASGIAEFWI
DGKPLGRKGVRKGYTVGAEAKIILGQEQDSFGGNFDAKQSFVGEIWDVSLWDYVLPLKDM
CDYSDGGNVLNWQALTYEENGYVVTKPSLWN
Download sequence
Identical sequences H0WCS6
10141.ENSCPOP00000020797 ENSCPOP00000020797 ENSCPOP00000020797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]