SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro01414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro01414
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.94e-41
Family PadR-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro01414
Sequence length 177
Comment (Rhodococcus jostii RHA1)
Sequence
MALEHALLVSLTEHSGSGYELARRFDKSIGFFQSATHQQIYRVLKRMDESGWVDAEVVAQ
VGRPDKKVYRVSAAGRAELERWIAEPTEPNHLRNELAVKIRAAQHGDIAALTAEVARHRD
GHAARLEVYRMIEKRDFPAPAQLSGAALHQYLVLRGGIRVEEGFADWCQEVLDALAQ
Download sequence
Identical sequences Q0SGV1
gi|111018421|ref|YP_701393.1| 101510.RHA1_ro01414 WP_011594436.1.53434 WP_011594436.1.60566 WP_011594436.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]